Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $90,038.42
PubMed Score 53.64
PubTator Score 11.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 0.002
posterior fossa group B ependymoma -2.300 0.000
glioblastoma multiforme -1.300 0.000
group 4 medulloblastoma -2.200 0.000
atypical teratoid/rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.300 0.000
adult high grade glioma -1.400 0.000
pituitary cancer 1.500 0.000

Gene RIF (2)

PMID Text
23558288 Furin-like proprotein convertase-dependent processing precedes the plasma membrane localization of LEDA-1/PIANP that is required for functional receptor-ligand interactions in vitro and in vivo.
21241660 These results suggest that PANP is involved in immune regulation as a ligand of the PILRalpha.

AA Sequence

MESRMWPALLLSHLLPLWPLLLLPLPPPAQGSSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRS      1 - 70
PRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLAT     71 - 140
PHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDPQLYVTITISIIIVLVATGIIFKFCWDRSQKRR    141 - 210
RPSGQQGALRQEESQQPLTDLSPAGVTVLGAFGDSPTPTPDHEEPRGGPRPGMPHPKGAPAFQLNRIPLV    211 - 280
NL                                                                        281 - 282
//

Text Mined References (9)

PMID Year Title
23558288 2013 Proteolytic cleavage of LEDA-1/PIANP by furin-like proprotein convertases precedes its plasma membrane localization.
21241660 2011 PANP is a novel O-glycosylated PILR? ligand expressed in neural tissues.
20578158 2010 Liver sinusoidal endothelium: a microenvironment-dependent differentiation program in rat including the novel junctional protein liver endothelial differentiation-associated protein-1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.