Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.66
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma 5572 2.00838814370434E-9
sonic hedgehog group medulloblastoma 1482 4.3774486016758E-8
pediatric high grade glioma 2712 2.83638069655796E-7
atypical teratoid / rhabdoid tumor 4369 8.02562948882369E-7
pilocytic astrocytoma 3086 1.14738247915073E-5
primitive neuroectodermal tumor 3031 5.02695716974619E-5
sarcoidosis 368 0.00477622625425906
adrenocortical carcinoma 1427 0.00481318262824601
medulloblastoma, large-cell 6234 0.012160769483101
osteosarcoma 7933 0.0199732919916986
Breast cancer 3099 0.0275551869816365
Disease Target Count Z-score Confidence
Inferior myocardial infarction 4 3.711 1.9
Lung adenoma 8 3.55 1.8

Expression

  Differential Expression (11)

Synonym

Accession Q8IYD9 I7HFJ6 Q6MZU3 Q6ZTL6
Symbols LAS2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MAKSKTKHRLCSQESSVSALLASCTLSGSNSSNSDGSFHYKDKLYRSASQALQAYIDDFDLGQIYPGAST      1 - 70
GKINIDEDFTNMSQFCNYIYKPNNAFENLDHKKHSNFISCRRHTVNDIDSMSLTTDDLLRLPADGSFSYT     71 - 140
YVGPSHRTSKKNKKCRGRLGSLDIEKNPHFQGPYTSMGKDNFVTPVIRSNINGKQCGDKIELLILKAKRN    141 - 210
LEQCTEELPKSMKKDDSPCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNNDN    211 - 280
QSCTLSGGKHHGPVEALKQMLFNLQAVQERFNQNKTTDPKEEIKQVSEDDFSKLQLKESMIPITRSLQKA    281 - 350
LHHLSRLRDLVDDTNGERSPKM                                                    351 - 372
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.