Property Summary

NCBI Gene PubMed Count 6
PubMed Score 14.66
PubTator Score 3.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adrenocortical carcinoma 1.145 4.8e-03
Astrocytoma, Pilocytic 1.100 1.5e-05
atypical teratoid / rhabdoid tumor 1.300 1.4e-04
Breast cancer 2.100 2.8e-02
glioblastoma 1.500 2.0e-09
group 3 medulloblastoma 1.400 2.9e-04
medulloblastoma, large-cell 1.200 1.2e-02
osteosarcoma -1.057 2.0e-02
pediatric high grade glioma 1.600 2.8e-07
primitive neuroectodermal tumor 2.200 5.0e-05
sarcoidosis 1.200 4.8e-03

AA Sequence

MAKSKTKHRLCSQESSVSALLASCTLSGSNSSNSDGSFHYKDKLYRSASQALQAYIDDFDLGQIYPGAST      1 - 70
GKINIDEDFTNMSQFCNYIYKPNNAFENLDHKKHSNFISCRRHTVNDIDSMSLTTDDLLRLPADGSFSYT     71 - 140
YVGPSHRTSKKNKKCRGRLGSLDIEKNPHFQGPYTSMGKDNFVTPVIRSNINGKQCGDKIELLILKAKRN    141 - 210
LEQCTEELPKSMKKDDSPCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLNNDN    211 - 280
QSCTLSGGKHHGPVEALKQMLFNLQAVQERFNQNKTTDPKEEIKQVSEDDFSKLQLKESMIPITRSLQKA    281 - 350
LHHLSRLRDLVDDTNGERSPKM                                                    351 - 372
//

Text Mined References (8)

PMID Year Title