Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.348 1.3e-02
adult high grade glioma 2.200 2.7e-05
Astrocytoma, Pilocytic 1.100 3.7e-03
atypical teratoid / rhabdoid tumor 1.600 2.2e-03
gastric carcinoma -1.400 1.3e-03
glioblastoma 2.000 4.2e-06
group 3 medulloblastoma 3.600 1.5e-06
lung carcinoma 2.800 8.8e-42
medulloblastoma, large-cell 2.300 1.5e-02
oligodendroglioma 1.200 2.1e-07
osteosarcoma -1.282 2.3e-02
ovarian cancer -1.800 2.5e-11
primitive neuroectodermal tumor 2.200 6.4e-03
psoriasis -1.500 2.1e-22

Gene RIF (1)

AA Sequence

MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPMDCFEVYSPEADQWTALPRLPTARA      1 - 70
GVAVTALGKRIMVIGGVGTNQLPLKVVEMYNIDEGKWKKRSMLREAAMGISVTAKDYRVYAAGGMGLDLR     71 - 140
PHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVLGGRQSKYAVNAFEVFDIETRSWTKFPNIPY    141 - 210
KRAFSSFVTLDNHLYSLGGLRQGRLYRQPKFLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRV    211 - 280
IVAGGLGNQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS    281 - 350
//

Text Mined References (6)

PMID Year Title