Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.97
PubTator Score 13.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession Q8IYB7 Q53S79 Q580W6 Q5XKH0 Q69YG5 Q6AW99 Q7Z4T6 Q8N9K9 hDIS3L2
Symbols FAM6A
PRLMNS
hDIS3L2

Gene

Gene RIF (5)

PMID Text
26809675 DIS3L2 interacts with Ago2 and governs target RNA-directed miRNA degradation.
24141620 DIS3L2 is the missing component of the LIN28-TUT4/7-DIS3L2 pathway required for the repression of let-7 in pluripotent cells.
23613427 in cellular models DIS3L2 knockdown is associated with abnormalities of cell growth and division
22306653 Germline mutations in DIS3L2 cause the Perlman syndrome of overgrowth and Wilms tumor susceptibility.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIFETYMSKEDVSEGLKRGTLIQ      1 - 70
GVLRINPKKFHEAFIPSPDGDRDIFIDGVVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESD     71 - 140
IPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKGREDGDAPVT    141 - 210
KDETTCISQDTRALSEKSLQRSAKVVYILEKKHSRAATGFLKLLADKNSELFRKYALFSPSDHRVPRIYV    211 - 280
PLKDCPQDFVARPKDYANTLFICRIVDWKEDCNFALGQLAKSLGQAGEIEPETEGILTEYGVDFSDFSSE    281 - 350
VLECLPQGLPWTIPPEEFSKRRDLRKDCIFTIDPSTARDLDDALSCKPLADGNFKVGVHIADVSYFVPEG    351 - 420
SDLDKVAAERATSVYLVQKVVPMLPRLLCEELCSLNPMSDKLTFSVIWTLTPEGKILDEWFGRTIIRSCT    421 - 490
KLSYEHAQSMIESPTEKIPAKELPPISPEHSSEEVHQAVLNLHGIAKQLRQQRFVDGALRLDQLKLAFTL    491 - 560
DHETGLPQGCHIYEYRESNKLVEEFMLLANMAVAHKIHRAFPEQALLRRHPPPQTRMLSDLVEFCDQMGL    561 - 630
PVDFSSAGALNKSLTQTFGDDKYSLARKEVLTNMCSRPMQMALYFCSGLLQDPAQFRHYALNVPLYTHFT    631 - 700
SPIRRFADVLVHRLLAAALGYRERLDMAPDTLQKQADHCNDRRMASKRVQELSTSLFFAVLVKESGPLES    701 - 770
EAMVMGILKQAFDVLVLRYGVQKRIYCNALALRSHHFQKVGKKPELTLVWEPEDMEQEPAQQVITIFSLV    771 - 840
EVVLQAESTALKYSAILKRPGTQGHLGPEKEEEESDGEPEDSSTS                             841 - 885
//

Text Mined References (27)

PMID Year Title
26809675 2016 Identification of factors involved in target RNA-directed microRNA degradation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141620 2013 Mammalian DIS3L2 exoribonuclease targets the uridylated precursors of let-7 miRNAs.
23756462 2013 Exonuclease hDIS3L2 specifies an exosome-independent 3'-5' degradation pathway of human cytoplasmic mRNA.
23613427 2013 Perlman syndrome: overgrowth, Wilms tumor predisposition and DIS3L2.
23576526 2013 Perlman Syndrome: Overgrowth, Wilms Tumor Predisposition and DIS3L2.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23503588 2013 The exoribonuclease Dis3L2 defines a novel eukaryotic RNA degradation pathway.
23486540 2013 Homozygous deletion of DIS3L2 exon 9 due to non-allelic homologous recombination between LINE-1s in a Japanese patient with Perlman syndrome.
More...