Property Summary

NCBI Gene PubMed Count 14
PubMed Score 37.60
PubTator Score 21.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung cancer 4,466
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.800 0.000
ovarian cancer 1.100 0.001

Synonym

Accession Q8IY81 B2RCA5 D3DU22 Q8N3A3 Q8WXX1 Q9BWM4 Q9NXT6
Symbols SPB1
EPCS3

Gene

Gene RIF (2)

PMID Text
22540864 Components of the FTSJ3 interactome identified by coimmunoprecipitation.
22195017 The results presented in this work indicate a close functional interaction between NIP7 and FTSJ3 during pre-rRNA processing and show that FTSJ3 participates in ribosome synthesis in human cells.

AA Sequence

MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQVAAKFMPVSS      1 - 70
LIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDVVLNDGAPNVGASWVHDAYSQAHLTLMA     71 - 140
LRLACDFLARGGSFITKVFRSRDYQPLLWIFQQLFRRVQATKPQASRHESAEIFVVCQGFLAPDKVDSKF    141 - 210
FDPKFAFKEVEVQAKTVTELVTKKKPKAEGYAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEEL    211 - 280
AQHPATTEDIRVCCQDIRVLGRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAG    281 - 350
TTKQPSKEEEEEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRERVELKMDLPGVSIADEGETGM    351 - 420
FSLSTIRGHQLLEEVTQGDMSAADTFLSDLPRDDIYVSDVEDDGDDTSLDSDLDPEELAGVRGHQGLRDQ    421 - 490
KRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRK    491 - 560
GRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLEGEEKDGISDSDSSTSSEEEESW    561 - 630
EPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGE    631 - 700
LPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNT    701 - 770
VDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQ    771 - 840
KKKHKRK                                                                   841 - 847
//

Text Mined References (27)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22540864 2012 Proteomic characterization of the human FTSJ3 preribosomal complexes.
22195017 2011 The human nucleolar protein FTSJ3 associates with NIP7 and functions in pre-rRNA processing.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...