Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.28
PubTator Score 3.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -3.100 1.1e-06
astrocytic glioma -3.000 1.2e-03
atypical teratoid / rhabdoid tumor -3.500 1.1e-12
Breast cancer -2.200 3.6e-12
cystic fibrosis 1.007 7.7e-03
ependymoma -3.200 1.8e-03
glioblastoma -2.800 1.1e-10
group 4 medulloblastoma -1.400 3.0e-02
intraductal papillary-mucinous adenoma (... -1.100 3.7e-04
intraductal papillary-mucinous carcinoma... -1.400 1.6e-04
intraductal papillary-mucinous neoplasm ... -1.100 8.7e-03
lung carcinoma 1.600 4.8e-28
medulloblastoma, large-cell -1.600 2.1e-02
oligodendroglioma -2.500 1.1e-02
Pick disease -1.200 2.6e-02
pituitary cancer -1.900 8.1e-08
primitive neuroectodermal tumor -3.200 9.6e-07
subependymal giant cell astrocytoma -2.695 3.2e-03

Gene RIF (3)

AA Sequence

MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGV      1 - 70
AVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFF     71 - 140
GDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVA    141 - 210
AILAIAGIVMMTYADGFHSHSVIGIALVVASASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFIT    211 - 280
CIPIILYFTKVEYWSSFDDIPWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTS    281 - 350
QIVFNGVRVIAIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA    351 - 420
R//

Text Mined References (8)

PMID Year Title