Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.11
PubTator Score 3.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.84196949320038E-28
ependymoma 2514 2.81655308461494E-19
atypical teratoid / rhabdoid tumor 4369 1.06505066454941E-12
Breast cancer 3099 3.64856748504564E-12
pediatric high grade glioma 2712 1.74806192641654E-8
glioblastoma 5572 6.31187456193145E-8
pituitary cancer 1972 8.08243156587694E-8
primitive neuroectodermal tumor 3031 9.6316090909655E-7
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.61397164170664E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.69337686565959E-4
astrocytic glioma 2241 0.00124670381928305
subependymal giant cell astrocytoma 2287 0.00320933146020639
cystic fibrosis 1670 0.00772765881173946
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00869246789307444
oligodendroglioma 2849 0.0108735359790966
medulloblastoma, large-cell 6234 0.0208744078067827
Pick disease 1893 0.0264965703367736
group 4 medulloblastoma 1875 0.0299207514964885

Expression

Synonym

Accession Q8IY50 Q5TDD6 Q8N9C9
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGV      1 - 70
AVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFF     71 - 140
GDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVA    141 - 210
AILAIAGIVMMTYADGFHSHSVIGIALVVASASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFIT    211 - 280
CIPIILYFTKVEYWSSFDDIPWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTS    281 - 350
QIVFNGVRVIAIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFA    351 - 420
R//

Text Mined References (8)

PMID Year Title
24509276 2014 Genetic implication of a novel thiamine transporter in human hypertension.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.