Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.67
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
aldosterone-producing adenoma -1.009 1.8e-02
atypical teratoid / rhabdoid tumor 1.600 1.3e-05
diabetes mellitus -1.100 1.9e-03
ependymoma 1.200 3.3e-04
gastric cancer -1.100 3.5e-03
glioblastoma 1.500 1.1e-05
group 4 medulloblastoma 1.300 3.4e-04
hepatocellular carcinoma -1.500 6.3e-05
malignant mesothelioma 1.200 1.1e-06
medulloblastoma, large-cell 1.800 1.1e-05
Multiple myeloma 1.005 3.3e-02
oligodendroglioma 1.200 5.3e-03
osteosarcoma 1.204 1.3e-02
ovarian cancer 1.700 2.2e-05
pancreatic cancer -1.400 4.2e-03
pancreatic carcinoma -1.400 4.2e-03
pediatric high grade glioma 1.100 2.2e-04
primary pancreatic ductal adenocarcinoma 1.359 8.1e-04
primitive neuroectodermal tumor 1.100 6.2e-03
tuberculosis and treatment for 6 months 1.300 1.5e-05

Synonym

Accession Q8IY47 A8K9T7 Q86Y62 Q9P239 Q9UFM7 Q9Y382
Symbols BKLHD1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSTQDERQINTEYAVSLLEQLKLFYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQT      1 - 70
HVHLRNVDAATLQIIITYAYTGNLAMNDSTVEQLYETACFLQVEDVLQRCREYLIKKINAENCVRLLSFA     71 - 140
DLFSCEELKQSAKRMVEHKFTAVYHQDAFMQLSHDLLIDILSSDNLNVEKEETVREAAMLWLEYNTESRS    141 - 210
QYLSSVLSQIRIDALSEVTQRAWFQGLPPNDKSVVVQGLYKSMPKFFKPRLGMTKEEMMIFIEASSENPC    211 - 280
SLYSSVCYSPQAEKVYKLCSPPADLHKVGTVVTPDNDIYIAGGQVPLKNTKTNHSKTSKLQTAFRTVNCF    281 - 350
YWFDAQQNTWFPKTPMLFVRIKPSLVCCEGYIYAIGGDSVGGELNRRTVERYDTEKDEWTMVSPLPCAWQ    351 - 420
WSAAVVVHDCIYVMTLNLMYCYFPRSDSWVEMAMRQTSRSFASAAAFGDKIFYIGGLHIATNSGIRLPSG    421 - 490
TVDGSSVTVEIYDVNKNEWKMAANIPAKRYSDPCVRAVVISNSLCVFMRETHLNERAKYVTYQYDLELDR    491 - 560
WSLRQHISERVLWDLGRDFRCTVGKLYPSCLEESPWKPPTYLFSTDGTEEFELDGEMVALPPV           561 - 623
//

Text Mined References (7)

PMID Year Title