Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 0.020
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.400 0.021
lung cancer -2.500 0.000
colon cancer -2.000 0.021
interstitial cystitis -2.100 0.000
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma -1.400 0.000
spina bifida -2.663 0.041
ductal carcinoma in situ -2.400 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRT      1 - 70
ADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPTQDDRGSWASTANTVPPTQPFLEGG     71 - 140
GTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKN    141 - 210
HTEDESLEGIQPPVGEHGLNTPFSVRRSWDSLNEDVETEVLSICFNEKGPVHAMPVVDSGNRQEDTHGSD    211 - 280
GDGDGEIVDEDAAVAEALAALEAATAGEDLDETD                                        281 - 314
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.