Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.31522826733758E-13
medulloblastoma 1524 1.08608168008262E-10
lung adenocarcinoma 2714 1.49184937094999E-8
nasopharyngeal carcinoma 1056 3.02863163236719E-7
atypical teratoid / rhabdoid tumor 4369 2.70695500867682E-6
medulloblastoma, large-cell 6234 5.11512829612219E-6
ductal carcinoma in situ 1745 2.71134339537246E-5
interstitial cystitis 2299 9.88478471495434E-5
lung cancer 4473 1.45556888227178E-4
glioblastoma 5572 2.83979591752112E-4
esophageal adenocarcinoma 737 0.01953668612729
primitive neuroectodermal tumor 3031 0.0209251105292423
colon cancer 1475 0.0213794086325305
spina bifida 1064 0.0409323319619009

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 0.020
medulloblastoma -2.200 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.400 0.000
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor -1.400 0.021
lung cancer -2.500 0.000
colon cancer -2.000 0.021
interstitial cystitis -2.100 0.000
lung adenocarcinoma -1.200 0.000
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma -1.400 0.000
spina bifida -2.663 0.041
ductal carcinoma in situ -2.400 0.000

Synonym

Accession Q8IY42 Q9NV03
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGCRCCKIIQSYLFDPVQVPSPGYVNEVNSCKLDEDDTDKLKGKWSSEVLVQKNDPQRQGSKKTESSSRT      1 - 70
ADPWEPCWPHQGPLPQGDAGGEHHACGVNGIGPAATPQPTGNSSPTQDDRGSWASTANTVPPTQPFLEGG     71 - 140
GTRKQDCVLLASEGTQVMRNGDSRAPSEAESFALEVQDHVFQIPAPDYLQHWGPAGDNVDHNEKDCVFKN    141 - 210
HTEDESLEGIQPPVGEHGLNTPFSVRRSWDSLNEDVETEVLSICFNEKGPVHAMPVVDSGNRQEDTHGSD    211 - 280
GDGDGEIVDEDAAVAEALAALEAATAGEDLDETD                                        281 - 314
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20802204 2010 Genetic variation influences glutamate concentrations in brains of patients with multiple sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.