Property Summary

NCBI Gene PubMed Count 12
Grant Count 40
R01 Count 7
Funding $8,138,649.17
PubMed Score 93.15
PubTator Score 35.50

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
26733200 Data suggest expression of transcription factor p8/SP8 is up-regulated in endoplasmic reticulum stress due to lipotoxicity; overexpression of SP8 up-regulates autophagy; autophagy due to lipotoxicity requires SP8; these reactions are mTOR-independent.
23967141 Genetic variants on 3q21 and in the Sp8 transcription factor gene (SP8) as susceptibility loci for psychotic disorders.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20386566 This study provided that SP8 are associated with Bipolar I in the Han Chinese population

AA Sequence

MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSASCNVVGSSLSSFGVSGASRNGGSSSAAA      1 - 70
AAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAAAAAAAASSSPFANDYSVFQAPGVSGGSGGG     71 - 140
GGGGGGGSSAHSQDGSHQPVFISKVHTSVDGLQGIYPRVGMAHPYESWFKPSHPGLGAAGEVGSAGASSW    141 - 210
WDVGAGWIDVQNPNSAAALPGSLHPAAGGLQTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLM    211 - 280
DGFKPVLPGSYPDSAPSPLAGAGGSMLSAGPSAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASL    281 - 350
RRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPV    351 - 420
CNKRFMRSDHLSKHVKTHSGGGGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPGHRNGLE    421 - 490
//

Text Mined References (13)

PMID Year Title
26733200 2016 The Transcription Factor p8 Regulates Autophagy in Response to Palmitic Acid Stress via a Mammalian Target of Rapamycin (mTOR)-independent Signaling Pathway.
23967141 2013 Genetic variants on 3q21 and in the Sp8 transcription factor gene (SP8) as susceptibility loci for psychotic disorders: a genetic association study.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20386566 2011 Genome-wide association study of bipolar I disorder in the Han Chinese population.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15533246 2004 Genomic structure and cloning of two transcript isoforms of human Sp8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...