Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 8.0e-08
lung adenocarcinoma 2716 6.0e-05

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.500 8.0e-08
lung adenocarcinoma -1.100 6.0e-05

Synonym

Accession Q8IXY8 A9NIU0 A9NIU9 E7EX15 PPIase
Symbols PPIase
RSPH12
bA425D10.6
dJ919F19.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQ      1 - 70
YLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTK     71 - 140
HDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQGG    141 - 210
DIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEG    211 - 280
TEVLKQLELVPTQNERPIHMCRITDSGDPYA                                           281 - 311
//

Text Mined References (5)

PMID Year Title