Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 3.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 2.100 0.000
lung adenocarcinoma -1.800 0.000

Synonym

Accession Q8IXY8 A9NIU0 A9NIU9 E7EX15 PPIase
Symbols PPIase
RSPH12
bA425D10.6
dJ919F19.1

Gene

PANTHER Protein Class (1)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MARPQPCGPPHARCGSPSLPERPLQVKVVGLFSCPNFQIAKSAAENLKNNHPSKFEDPILVPLQEFAWHQ      1 - 70
YLQEKKRELKNETWEYSSSVISFVNGQFLGDALDLQKWAHEVWDIVDIKPSALYDALTEDFSAKFLRDTK     71 - 140
HDFVFLDICIDSSPIGRLIFELYCDVCPKTCKNFQVLCTGKAGFSQRGIRLHYKNSIFHRIVQNGWIQGG    141 - 210
DIVYGKGDNGESIYGPTFEDENFSVPHNKRGVLGMANKGRHSNGSQFYITLQATPYLDRKFVAFGQLIEG    211 - 280
TEVLKQLELVPTQNERPIHMCRITDSGDPYA                                           281 - 311
//

Text Mined References (5)

PMID Year Title
18391951 2008 Many sequence variants affecting diversity of adult human height.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.