Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.39
PubTator Score 3.38

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.900 9.3e-07
gastric cancer 1.100 6.1e-04
nasopharyngeal carcinoma -1.200 5.5e-08
osteosarcoma -1.826 2.4e-07
tuberculosis 1.500 1.1e-04

Gene RIF (2)

AA Sequence

MPKKEKMAKTPLSDEKQLLLFQQKLLAEEEMAKKKERLLSQFLKDKLAKEEHNSALNLNKINTQWRTVLR      1 - 70
EVKTRELHKDIEILSQTFERVVDCKDNVIKSLAKDLSEAEEQYAHALRSHLHNVDQLLALQRHRLSLLEE     71 - 140
SYNMELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQNYIDSEYESKLEFQSMWNDLKNMNLEEKHF    141 - 210
LRLHLENRVEDLWRKFQDVLKNYTDATEDRKAAFETLQVKDEKSSKEIEVQMKKIQKLQDAITISKGKIM    211 - 280
IHSRESEDENRYIRNDKELVLVQLRKLKAQRTQARAASQKNLVRLTLESNATLKALRKIVDKGEKILKLA    281 - 350
EICRKFETEEEKVLPFYSSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQH    351 - 420
RRAQLLDINGKLREMLKQYLDGISVSDEVLSQLNPLFIVNYQSNLLQPLSIRIAHPGDKQHPTT          421 - 484
//

Text Mined References (10)

PMID Year Title