Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
R01 Count 3
Funding $142,226.11
PubMed Score 9.67
PubTator Score 3.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
gastric cancer 1.200 0.001
osteosarcoma -1.826 0.000
posterior fossa group B ependymoma 4.100 0.000
tuberculosis 1.500 0.000
nasopharyngeal carcinoma -1.200 0.000

Gene RIF (2)

PMID Text
23991085 Mutation in CCDC65, a nexin-dynein regulatory complex member, resulted in a frameshift mutation and PCD
17089017 NYD-SP28, a sperm tail protein, was cloned and characterized.

AA Sequence

MPKKEKMAKTPLSDEKQLLLFQQKLLAEEEMAKKKERLLSQFLKDKLAKEEHNSALNLNKINTQWRTVLR      1 - 70
EVKTRELHKDIEILSQTFERVVDCKDNVIKSLAKDLSEAEEQYAHALRSHLHNVDQLLALQRHRLSLLEE     71 - 140
SYNMELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQNYIDSEYESKLEFQSMWNDLKNMNLEEKHF    141 - 210
LRLHLENRVEDLWRKFQDVLKNYTDATEDRKAAFETLQVKDEKSSKEIEVQMKKIQKLQDAITISKGKIM    211 - 280
IHSRESEDENRYIRNDKELVLVQLRKLKAQRTQARAASQKNLVRLTLESNATLKALRKIVDKGEKILKLA    281 - 350
EICRKFETEEEKVLPFYSSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQH    351 - 420
RRAQLLDINGKLREMLKQYLDGISVSDEVLSQLNPLFIVNYQSNLLQPLSIRIAHPGDKQHPTT          421 - 484
//

Text Mined References (10)

PMID Year Title
24094744 2013 Zebrafish Ciliopathy Screen Plus Human Mutational Analysis Identifies C21orf59 and CCDC65 Defects as Causing Primary Ciliary Dyskinesia.
23991085 2013 CCDC65 mutation causes primary ciliary dyskinesia with normal ultrastructure and hyperkinetic cilia.
21700706 2011 Building blocks of the nexin-dynein regulatory complex in Chlamydomonas flagella.
17089017 2006 Cloning and characterization of a novel sperm tail protein, NYD-SP28.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.