Property Summary

NCBI Gene PubMed Count 15
Grant Count 62
R01 Count 12
Funding $9,225,446.98
PubMed Score 18.29
PubTator Score 151.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IXQ6 A8KA94 B2R8S9 E9PFM7 Q8TCP3 Q9BZL8 Q9BZL9 PARP-9
Symbols BAL
BAL1
ARTD9
MGC:7868

Gene

PANTHER Protein Class (1)

PDB

5AIL  

Gene RIF (7)

PMID Text
24886089 The present study further suggests that the combined targeted inhibition of STAT1, ARTD8, ARTD9 and/or DTX3L could increase the efficacy of chemotherapy or radiation treatment in prostate and other high-risk tumor types with an increased STAT1 signaling.
23898208 HIV-1 Tat upregulates the expression of poly (ADP-ribose) polymerase family, member 9 (PARP9) in human primary T cells
23487038 BAL1 represses the anti-proliferative and pro-apoptotic IFNgamma-STAT1-IRF1-p53 axis and mediates proliferation, survival and chemo-resistance in DLBCL.
23230272 Data establish that BAL1 and BBAP are bona fide members of a DNA damage response pathway and are directly associated with PARP1 activation, BRCA1 recruitment, and double-strand break repair.
18854154 Knockdown of poly (ADP-ribose) polymerase family, member 9 (PARP9) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18339380 Determination of Poly (ADP-ribose) polymerase (PARP) homologues in human ejaculated sperm and its correlation with sperm maturation.
16809771 BAL1 and BBAP are located on chromosome 3q21 in a head-to-head orientation and are regulated by a IFN-gamma-responsive bidirectional promoter.

AA Sequence

MDFSMVAGAAAYNEKSGRITSLSLLFQKVFAQIFPQWRKGNTEECLPYKCSETGALGENYSWQIPINHND      1 - 70
FKILKNNERQLCEVLQNKFGCISTLVSPVQEGNSKSLQVFRKMLTPRIELSVWKDDLTTHAVDAVVNAAN     71 - 140
EDLLHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQIIHAVGPRWMEWDKQGCT    141 - 210
GKLQRAIVSILNYVIYKNTHIKTVAIPALSSGIFQFPLNLCTKTIVETIRVSLQGKPMMSNLKEIHLVSN    211 - 280
EDPTVAAFKAASEFILGKSELGQETTPSFNAMVVNNLTLQIVQGHIEWQTADVIVNSVNPHDITVGPVAK    281 - 350
SILQQAGVEMKSEFLATKAKQFQRSQLVLVTKGFNLFCKYIYHVLWHSEFPKPQILKHAMKECLEKCIEQ    351 - 420
NITSISFPALGTGNMEIKKETAAEILFDEVLTFAKDHVKHQLTVKFVIFPTDLEIYKAFSSEMAKRSKML    421 - 490
SLNNYSVPQSTREEKRENGLEARSPAINLMGFNVEEMYEAHAWIQRILSLQNHHIIENNHILYLGRKEHD    491 - 560
ILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNIEDMLCKVQEEMARKKERGLWRSLGQWTIQQ    561 - 630
QKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVS    631 - 700
HRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGF    701 - 770
FCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFA    771 - 840
QHPWRGFASGSPVD                                                            841 - 854
//

Text Mined References (18)

PMID Year Title
24886089 2014 DTX3L and ARTD9 inhibit IRF1 expression and mediate in cooperation with ARTD8 survival and proliferation of metastatic prostate cancer cells.
23487038 2013 BAL1/ARTD9 represses the anti-proliferative and pro-apoptotic IFN?-STAT1-IRF1-p53 axis in diffuse large B-cell lymphoma.
23230272 2013 BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
19946888 2010 Defining the membrane proteome of NK cells.
18339380 2009 Determination of Poly (ADP-ribose) polymerase (PARP) homologues in human ejaculated sperm and its correlation with sperm maturation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16809771 2006 BAL1 and BBAP are regulated by a gamma interferon-responsive bidirectional promoter and are overexpressed in diffuse large B-cell lymphomas with a prominent inflammatory infiltrate.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...