Uncharacterized protein C11orf53

Property Summary

NCBI Gene PubMed Count	4
PubMed Score	0.71

PubTator Score	1.70

Knowledge Summary

Patent

No data available

Expression

Specificity
Differential

Testis 18,518

Breast - Mammary Tissue 18,103

Colon - Transverse 17,825

Small Intestine - Terminal Ileum 17,954

Nerve - Tibial 18,007

Adipose - Subcutaneous 18,110

Minor Salivary Gland 18,005

Pituitary 18,147

Prostate 18,213

Muscle - Skeletal 17,778

Ovary 17,971

Spleen 17,614

Pancreas 18,123

Uterus 17,618

Cells - EBV-transformed lymphocytes 18,186

Lung 18,057

Thyroid 18,024

Esophagus - Muscularis 18,017

Vagina 17,834

Stomach 17,879

Esophagus - Mucosa 18,076

Adipose - Visceral (Omentum) 17,937

Esophagus - Gastroesophageal Junction 18,000

Skin - Sun Exposed (Lower leg) 17,968

Brain - Cerebellum 17,983

Colon - Sigmoid 18,089

Brain - Cortex 18,039

Brain - Hypothalamus 18,169

Skin - Not Sun Exposed (Suprapubic) 18,081

Brain - Amygdala 18,006

Whole Blood 17,439

Brain - Cerebellar Hemisphere 18,015

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Spinal cord (cervical c-1) 17,973

Brain - Substantia nigra 17,981

Cells - Transformed fibroblasts 17,577

Kidney - Cortex 17,329

Artery - Tibial 17,631

Heart - Left Ventricle 18,006

Artery - Coronary 17,949

Brain - Hippocampus 18,011

Heart - Atrial Appendage 17,896

Brain - Frontal Cortex (BA9) 18,069

Liver 18,071

Brain - Caudate (basal ganglia) 18,001

Brain - Putamen (basal ganglia) 17,863

Brain - Anterior cingulate cortex (BA24) 17,989

adipose tissue 15,837

appendix 16,247

breast 16,063

colon 15,959

duodenum 15,975

endometrium 16,349

fallopian tube 16,245

gallbladder 16,333

kidney 15,917

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

skeletal muscle 14,011

small intestine 16,154

stomach 16,099

testis 17,936

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

See source...

See source...

Synonym

Accession	Q8IXP5
Symbols

Gene

C11orf53

Ortholog (11)

Species	Source	Disease
Platypus 5,703	OMA EggNOG
Anole lizard 10,588	OMA EggNOG
Chimp 14,140	OMA EggNOG
Macaque 12,761	OMA EggNOG
Mouse 16,570	Inparanoid OMA EggNOG
Rat 15,117	Inparanoid OMA EggNOG
Dog 15,073	OMA EggNOG
Horse 14,252	OMA EggNOG
Cow 15,320	OMA EggNOG
Pig 10,168	OMA EggNOG
Opossum 12,230	Inparanoid OMA EggNOG

UniProt Keyword (2)

Complete proteome 20,231

Reference proteome 20,231

Compartment GO Term (0)

GWAS Trait (3)

Major depressive disorder 94

Body mass index 379

Carotid plaque burden 31

HCA RNA Cell Line (11)

BJ 15,448

Daudi 15,753

EFO-21 17,301

RT4 15,683

SH-SY5Y 16,707

SiHa 15,286

SK-BR-3 16,008

T-47d 16,213

U-698 16,279

U-266/70 16,745

See all...

AA Sequence

MPGSPVTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRP      1 - 70
PALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDPVSADALLTLPPSTSCLSQLE     71 - 140
SGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKVGPLSPDEEADTG    141 - 210
SLHDPSPWVKEDGSIAWGSYECRRAY                                                211 - 236
//

Text Mined References (4)

Summary
Details

	PMID	Year	Title