Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.71
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPGSPVTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRP      1 - 70
PALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDPVSADALLTLPPSTSCLSQLE     71 - 140
SGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKVGPLSPDEEADTG    141 - 210
SLHDPSPWVKEDGSIAWGSYECRRAY                                                211 - 236
//

Text Mined References (4)

PMID Year Title