Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.71
PubTator Score 1.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IXP5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPGSPVTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRP      1 - 70
PALTPNAGSLFSASPLPPLLPPPFPGDPAHFLFRDSWEQTLPDGLSQPDPVSADALLTLPPSTSCLSQLE     71 - 140
SGSIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSNDLPPKVGPLSPDEEADTG    141 - 210
SLHDPSPWVKEDGSIAWGSYECRRAY                                                211 - 236
//

Text Mined References (4)

PMID Year Title
25048349 Open reading frames associated with cancer in the dark matter of the human genome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.