Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.06
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 0.008
posterior fossa group A ependymoma -1.700 0.000
glioblastoma -1.500 0.000
sonic hedgehog group medulloblastoma -2.000 0.000
atypical teratoid/rhabdoid tumor -1.800 0.000
primitive neuroectodermal tumor -1.200 0.000
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.300 0.000
ovarian cancer 1.100 0.000
psoriasis -1.100 0.000

AA Sequence

MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQKALTTFPDVV      1 - 70
LVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAGHGVPMPDTFSYGGHEDFSKM     71 - 140
IDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGQVI    141 - 210
GSMLRCSTDGRMQSNCSLGGVGVKCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGF    211 - 280
LAFDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSE    281 - 350
SEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELKLK                                 351 - 391
//

Text Mined References (6)

PMID Year Title
21454531 2011 N-acetylaspartylglutamate synthetase II synthesizes N-acetylaspartylglutamylglutamate.
20657015 2010 Molecular identification of N-acetylaspartylglutamate synthase and beta-citrylglutamate synthase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.