Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.07
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 2.7e-05
astrocytic glioma -1.100 8.4e-03
Astrocytoma, Pilocytic -1.400 9.5e-08
atypical teratoid / rhabdoid tumor -1.700 1.1e-09
ependymoma -1.200 4.0e-03
glioblastoma -1.500 1.2e-10
group 3 medulloblastoma -1.400 2.4e-04
ovarian cancer 1.100 2.1e-07
primitive neuroectodermal tumor -1.200 4.2e-04
psoriasis -1.100 2.2e-28

AA Sequence

MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQKALTTFPDVV      1 - 70
LVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAGHGVPMPDTFSYGGHEDFSKM     71 - 140
IDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGQVI    141 - 210
GSMLRCSTDGRMQSNCSLGGVGVKCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGF    211 - 280
LAFDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSE    281 - 350
SEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELKLK                                 351 - 391
//

Text Mined References (6)

PMID Year Title