Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.85
PubTator Score 20.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 2.4e-07
ovarian cancer 8520 2.3e-06
glioblastoma 5792 2.4e-05
tuberculosis 2010 1.3e-04
osteosarcoma 7950 5.1e-04
dermatomyositis 966 9.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Parkinson's disease 392 3.121 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.200 2.4e-07
dermatomyositis 1.100 9.4e-03
glioblastoma -1.300 2.4e-05
osteosarcoma -1.258 5.1e-04
ovarian cancer -1.600 2.3e-06
tuberculosis 1.100 1.3e-04

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQ      1 - 70
EISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTE     71 - 140
IETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAELN    141 - 210
FFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDL    211 - 280
DLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC    281 - 350
TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR    351 - 420
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD    421 - 490
VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCN    491 - 560
TADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR                561 - 618
//

Text Mined References (35)

PMID Year Title