Property Summary

NCBI Gene PubMed Count 28
Grant Count 14
R01 Count 8
Funding $1,510,188.85
PubMed Score 26.69
PubTator Score 20.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.258 0.001
glioblastoma -1.300 0.000
tuberculosis 1.100 0.000
ovarian cancer -1.600 0.000
Breast cancer -1.200 0.000
dermatomyositis 1.100 0.009

Gene RIF (13)

PMID Text
26658612 Full-length APC promotes assembly of the Miro-1/Milton-2 complex.
26259702 Miro and Cenp-F promote anterograde mitochondrial movement and proper mitochondrial distribution in daughter cells.
24671417 Data indicate that outer mitochondrial membrane protein Miro1 can stabilize phospho-mutant versions of PARK2 gene (encoding Parkin) on the outer mitochondrial membrane (OMM).
24492963 CXCL12-dependent cell polarization and migration are reduced in Miro-1-silenced cells
24256248 The Miro1-mediated mitochondrial transport in neurons and recently highlighted involvement of Miro1 proteins in mitochondrial turnover, emerging as a key process affected in neurodegeneration.
24092329 Details of a robust association of DISC1 with mitochondrial transport complexes containing TRAK1 and Miro1.
22860091 results indicated that the low-expression levels of RhoT1 and Smad4 were significantly associated with LNM and shorter survival. RhoT1 may be considered as a potential novel marker for predicting the outcome in patients with pancreatic cancer
22078885 Study shows that both PINK1 and Parkin halt mitochondrial movement; PINK1 phosphorylates Miro (1 and 2) and thereby initiates the rapid degradation of Miro through a Parkin- and proteasome-dependent pathway.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQ      1 - 70
EISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTE     71 - 140
IETCVECSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAELN    141 - 210
FFQRICFNTPLAPQALEDVKNVVRKHISDGVADSGLTLKGFLFLHTLFIQRGRHETTWTVLRRFGYDDDL    211 - 280
DLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPDELKDLFKVFPYIPWGPDVNNTVC    281 - 350
TNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGYSILTEQESQASAVTVTRDKKIDLQKKQTQRNVFR    351 - 420
CNVIGVKNCGKSGVLQALLGRNLMRQKKIREDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAEIICD    421 - 490
VVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCN    491 - 560
TADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGATVFAVLGFAMYKALLKQR                561 - 618
//

Text Mined References (34)

PMID Year Title
26658612 2016 APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane.
26259702 2015 Mitotic redistribution of the mitochondrial network by Miro and Cenp-F.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24995978 2014 Glucose regulates mitochondrial motility via Milton modification by O-GlcNAc transferase.
24896179 2014 The mitochondrial deubiquitinase USP30 opposes parkin-mediated mitophagy.
24671417 2014 Lysine 27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
24492963 2014 Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256248 2013 Mitochondrial trafficking in neurons and the role of the Miro family of GTPase proteins.
24092329 2014 DISC1 complexes with TRAK1 and Miro1 to modulate anterograde axonal mitochondrial trafficking.
More...