Property Summary

NCBI Gene PubMed Count 2
PubMed Score 10.85
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLLLTLLFLLFLA      1 - 70
HGVTLDGASANPTVSLQEFLMAEQSLPGTLLKLAAQGLGMQAACTLMRLCWAWELSDLHLLQSLMAQSCS     71 - 140
SALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAYSGPAVALLVTVTAYTAGPFTSAFFNPALAASVTFA    141 - 210
CSGHTLLEYVQVYWLGPLTGMVLAVLLHQGRLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSS    211 - 280
VREPGRSGVEGPHSS                                                           281 - 295
//

Text Mined References (2)

PMID Year Title