Property Summary

NCBI Gene PubMed Count 2
Grant Count 3
Funding $110,250
PubMed Score 8.92
PubTator Score 7.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Retinal Vein Occlusion 6 3.004 1.5

Gene RIF (2)

PMID Text
23359558 Built accurate 3D-models for AQP11 and AQP12 and comprehensively compared their sequence and structure to other known aquaporins.
15809071 a role of AQP12 in digestive enzyme secretion such as maturation and exocytosis of secretory granules

AA Sequence

MAGLNVSLSFFFATFALCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLLLTLLFLLFLA      1 - 70
HGVTLDGASANPTVSLQEFLMAEQSLPGTLLKLAAQGLGMQAACTLMRLCWAWELSDLHLLQSLMAQSCS     71 - 140
SALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAYSGPAVALLVTVTAYTAGPFTSAFFNPALAASVTFA    141 - 210
CSGHTLLEYVQVYWLGPLTGMVLAVLLHQGRLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSS    211 - 280
VREPGRSGVEGPHSS                                                           281 - 295
//

Text Mined References (2)

PMID Year Title
23359558 2013 In silico study of human aquaporin AQP11 and AQP12 channels.
15809071 2005 Identification of a novel aquaporin, AQP12, expressed in pancreatic acinar cells.