Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.27
PubTator Score 9.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.200 6.6e-04
atypical teratoid / rhabdoid tumor 1.500 2.0e-07
Breast cancer 1.100 5.2e-08
breast carcinoma 1.200 1.5e-05
glioblastoma 1.200 1.6e-06
group 3 medulloblastoma 2.000 1.7e-05
lung adenocarcinoma 1.100 4.6e-07
medulloblastoma, large-cell 1.900 2.0e-06
non-small cell lung cancer 1.053 5.3e-18
primitive neuroectodermal tumor 1.400 1.5e-03
psoriasis 2.000 3.2e-127

Gene RIF (9)

AA Sequence

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ      1 - 70
EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD     71 - 140
PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM    141 - 210
DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY    211 - 280
TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS    281 - 350
SYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN            351 - 412
//

Text Mined References (27)

PMID Year Title