Property Summary

NCBI Gene PubMed Count 18
Grant Count 1
Funding $135,743.33
PubMed Score 11.72
PubTator Score 9.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Synonym

Accession Q8IX90 A2A330 A2A331 B2RBY2 Q5VZV5 Q86WR2 Q8NBG1 Q96D22
Symbols RAMA1
C13orf3

Gene

 Grant Application (1)

PDB

4AJ5  

Gene RIF (7)

PMID Text
26429724 over-expression of GNL3 and SKA3 in the PC-3 human prostate cancer cell line decreased in vitro cell migration and invasion
22483620 The structure of the Ska core complex is a W-shaped dimer of coiled coils, formed by intertwined interactions between Ska1, Ska2, and Ska3.
22371557 Data suggest that Aurora B phosphorylation antagonizes the interaction between the Ska1-3 complex and the KMN network, thereby controlling Ska recruitment to KTs and stabilization of KT-MT attachments.
19646878 Ska3 functions to coordinate checkpoint signaling from the microtubule binding sites within a kinetochore by laterally linking the individual binding sites.
19549680 RAMA1 is a novel kinetochore protein involved in kinetochore-microtubule attachment.
19387489 These data identify C13orf3 (Ska3) as an important factor for metaphase to anaphase progression and highlight the potential of combined RNAi screening and protein localisation analyses.
19360002 C13Orf3 (now termed Ska3) localizes to the spindle and kinetochore throughout mitosis and its depletion markedly delays anaphase transition.

AA Sequence

MDPIRSFCGKLRSLASTLDCETARLQRALDGEESDFEDYPMRILYDLHSEVQTLKDDVNILLDKARLENQ      1 - 70
EGIDFIKATKVLMEKNSMDIMKIREYFQKYGYSPRVKKNSVHEQEAINSDPELSNCENFQKTDVKDDLSD     71 - 140
PPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQSLVKVLKTPKCALKM    141 - 210
DDFECVTPKLEHFGISEYTMCLNEDYTMGLKNARNNKSEEAIDTESRLNDNVFATPSPIIQQLEKSDAEY    211 - 280
TNSPLVPTFCTPGLKIPSTKNSIALVSTNYPLSKTNSSSNDLEVEDRTSLVLNSDTCFENLTDPSSPTIS    281 - 350
SYENLLRTPTPPEVTKIPEDILQLLSKYNSNLATPIAIKAVPPSKRFLKHGQNIRDVSNKEN            351 - 412
//

Text Mined References (24)

PMID Year Title
26429724 2015 GNL3 and SKA3 are novel prostate cancer metastasis susceptibility genes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085020 2012 The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.
22483620 2012 Structural and functional organization of the Ska complex, a key component of the kinetochore-microtubule interface.
22371557 2012 Aurora B controls kinetochore-microtubule attachments by inhibiting Ska complex-KMN network interaction.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20813266 2010 The protein composition of mitotic chromosomes determined using multiclassifier combinatorial proteomics.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19646878 2009 Ska3 is required for spindle checkpoint silencing and the maintenance of chromosome cohesion in mitosis.
More...