Property Summary

NCBI Gene PubMed Count 26
Grant Count 111
R01 Count 63
Funding $11,591,844.41
PubMed Score 310.89
PubTator Score 870.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 2.336 0.000
juvenile dermatomyositis -1.085 0.000

Synonym

Accession Q8IX07
Symbols FOG
FOG1
ZNF408
ZNF89A
ZC2HC11A

Gene

PDB

2XU7  

Gene RIF (18)

PMID Text
26503584 GAB2, GSPT1, TFDP2 and ZFPM1 are four new susceptibility loci for testicular germ cell tumor.
25165715 Our results reveal that the protein structure does not affect ligand binding, and the top three TCM candidates Bittersweet alkaloid II, Eicosandioic acid, and Perivine might resolve the instability of the RbAp48-FOG1 complex
25162672 FOG1 is a member of the PR domain containing, zinc finger protein family of transcriptional regulators.
24179092 FOG1, FOG2 and GATA-6 modulate the transcriptional up-regulation of HAMP in hepatocytes during inflammation.
21646796 ZFPM1 that facilitates human Th1 differentiation via the downregulation of IL-4 is a potential target for the treatment of allergic diseases.
21047798 The FOG-1 peptide contacts a negatively charged binding pocket on top of the RbAp48 beta-propeller that is distinct from the binding surface used by RpAp48 to contact histone H4
20586925 Anagrelide suppresses megakaryocytopoiesis by reducing the expression levels of GATA-1 and FOG-1 via a PDEIII-independent mechanism that is differentiation context-specific and does not involve inhibition of MPL-mediated early signal transduction events
19692168 Observational study of gene-disease association. (HuGE Navigator)
19654328 two novel mechanisms for the regulation of GATA1 interaction with FOG1-dependent protein complexes through the production of two translational isoforms with differential interaction profiles and independent nuclear localization controls.
19625176 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSRRKQSNPRQIKRSLGDMEAREEVQLVGASHMEQKATAPEAPSPPSADVNSPPPLPPPTSPGGPKELEG      1 - 70
QEPEPRPTEEEPGSPWSGPDELEPVVQDGQRRIRARLSLATGLSWGPFHGSVQTRASSPRQAEPSPALTL     71 - 140
LLVDEACWLRTLPQALTEAEANTEIHRKDDALWCRVTKPVPAGGLLSVLLTAEPHSTPGHPVKKEPAEPT    141 - 210
CPAPAHDLQLLPQQAGMASILATAVINKDVFPCKDCGIWYRSERNLQAHLLYYCASRQGTGSPAAAATDE    211 - 280
KPKETYPNERVCPFPQCRKSCPSASSLEIHMRSHSGERPFVCLICLSAFTTKANCERHLKVHTDTLSGVC    281 - 350
HSCGFISTTRDILYSHLVTNHMVCQPGSKGEIYSPGAGHPATKLPPDSLGSFQQQHTALQGPLASADLGL    351 - 420
APTPSPGLDRKALAEATNGEARAEPLAQNGGSSEPPAAPRSIKVEAVEEPEAAPILGPGEPGPQAPSRTP    421 - 490
SPRSPAPARVKAELSSPTPGSSPVPGELGLAGALFLPQYVFGPDAAPPASEILAKMSELVHSRLQQGAGA    491 - 560
GAGGAQTGLFPGAPKGATCFECEITFSNVNNYYVHKRLYCSGRRAPEDAPAARRPKAPPGPARAPPGQPA    561 - 630
EPDAPRSSPGPGAREEGAGGAATPEDGAGGRGSEGSQSPGSSVDDAEDDPSRTLCEACNIRFSRHETYTV    631 - 700
HKRYYCASRHDPPPRRPAAPPGPPGPAAPPAPSPAAPVRTRRRRKLYELHAAGAPPPPPPGHAPAPESPR    701 - 770
PGSGSGSGPGLAPARSPGPAADGPIDLSKKPRRPLPGAPAPALADYHECTACRVSFHSLEAYLAHKKYSC    771 - 840
PAAPPPGALGLPAAACPYCPPNGPVRGDLLEHFRLAHGLLLGAPLAGPGVEARTPADRGPSPAPAPAASP    841 - 910
QPGSRGPRDGLGPEPQEPPPGPPPSPAAAPEAVPPPPAPPSYSDKGVQTPSKGTPAPLPNGNHRYCRLCN    911 - 980
IKFSSLSTFIAHKKYYCSSHAAEHVK                                                981 - 1006
//

Text Mined References (34)

PMID Year Title
26503584 2015 Identification of four new susceptibility loci for testicular germ cell tumour.
25165715 2014 Lead discovery for Alzheimer's disease related target protein RbAp48 from traditional Chinese medicine.
25162672 2014 The identification and structure of an N-terminal PR domain show that FOG1 is a member of the PRDM family of proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24179092 2013 Friend of GATA and GATA-6 modulate the transcriptional up-regulation of hepcidin in hepatocytes during inflammation.
24049095 2013 Genome-wide association study of sex hormones, gonadotropins and sex hormone-binding protein in Chinese men.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21646796 2011 Zinc finger protein, multitype 1, suppresses human Th2 development via downregulation of IL-4.
21047798 2011 Insights into association of the NuRD complex with FOG-1 from the crystal structure of an RbAp48·FOG-1 complex.
More...