Property Summary

NCBI Gene PubMed Count 20
PubMed Score 126.46
PubTator Score 76.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7766 6.8e-07
psoriasis 6514 1.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 3.0
Lipid metabolism disorder 111 0.0 3.0

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.858 6.8e-07
psoriasis -1.100 1.4e-03

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVASPQPPHPGEI      1 - 70
TNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPSAGKRSLLISRRTGLGLASLP     71 - 140
GPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKVSPPEGAETRKVIEKLARFVAEGGPELEKVA    141 - 210
MEDYKDNPAFAFLHDKNSREFLYYRKKVAEIRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPE    211 - 280
VETIALQNNRENQAFSFLYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPA    281 - 350
TTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG    351 - 420
LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVD    421 - 490
SELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKL    491 - 560
TVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAY    561 - 630
RFRPNPLNNPRRPYY                                                           631 - 645
//

Text Mined References (30)

PMID Year Title