Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 2.2e-18
psoriasis 6694 4.0e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Endometrial cancer 311 0.0 0.6

AA Sequence

MNSGISQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQDIPILTQCFECIKTIQQRNLKTNIRL      1 - 70
KKMASLARKASLWLFLSSEEQMCGIHRETKKMFCEVDRSLLCLLCSSSQEHRYHRHCPAEWAAEEHWEKL     71 - 140
LKKMQSLWEKACENQRNLNVETTRISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF      141 - 208
//

Text Mined References (2)

PMID Year Title