Property Summary

NCBI Gene PubMed Count 16
PubMed Score 100.55
PubTator Score 120.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.631 0.000

Synonym

Accession Q8IWY9 Q6NYD0 Q7Z7L5 Q969N3
Symbols DLT
CDA1
CDAI
CDAN1A
PRO1295

Gene

  Ortholog (11)

Pathway (1)

Gene RIF (9)

PMID Text
24196372 The proband with congenital dyserythropoietic anemia Iota in the first family was a compound heterozygote of CDAN1 with mutation IVS-12+2T>C and c. 3389C>T.
23716552 The missense substitution in CDAN1, C15ORF41, encodes a novel restriction endonuclease in congenital dyserythropoietic anemia type I.
22407294 The authors propose that Codanin-1 acts as a negative regulator of Asf1 function in chromatin assembly.
21364188 A link between mutant codanin-1 and the aberrant localization of HP1 alpha is supported by the finding that codanin-1 can be coimmunoprecipitated by anti-HP1 alpha antibodies erythroblasts from patients with congenital dyserythropoietic anemia type 1.
19336738 Data suggest that codanin-1 is a cell cycle-regulated protein active in the S phase.
18575862 Congenital dyserythropoietic anemia I (CDA I) is a well-defined entity within the heterogeneous group of the CDAN1 family; here it is associated with mutations in a Chinese family.
18081704 This second case of retinal angioid streaks in CDA I reports a patient homozygous for the Arg1042Trp mutation in codanin-1.
16767397 codanin-1 may play a role in the development of the skeleton.
12434312 Congenital dyserythropoietic anemia type I is caused by mutations in codanin-1

AA Sequence

MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQSSRVLPQGPP      1 - 70
TPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGGRRRGPGPARERGGRGLEEGV     71 - 140
SGESLPGAGGRRLRGSGSPSRPSLTLSDPPNLSNLEEFPPVGSVPPGPTGTKPSRRINPTPVSEERSLSK    141 - 210
PKTCFTSPPISCVPSSQPSALDTSPWGLGLPPGCRSLQEEREMLRKERSKQLQQSPTPTCPTPELGSPLP    211 - 280
SRTGSLTDEPADPARVSSRQRLELVALVYSSCIAENLVPNLFLELFFVFQLLTARRMVTAKDSDPELSPA    281 - 350
VLDSLESPLFQSIHDCVFFAVQVLECHFQVLSNLDKGTLKLLAENERLLCFSPALQGRLRAAYEGSVAKV    351 - 420
SLVMPPSTQAVSFQPETDNRANFSSDRAFHTFKKQRDVFYEVLREWEDHHEEPGWDFEKGLGSRIRAMMG    421 - 490
QLSAACSHSHFVRLFQKQLLQMCQSPGGAGGTVLGEAPDVLSMLGADKLGRLWRLQERLMAPQSSGGPCP    491 - 560
PPTFPGCQGFFRDFILSASSFQFNQHLMDSLSLKIQELNGLALPQHEPNDEDGESDVDWQGERKQFAVVL    561 - 630
LSLRLLAKFLGFVAFLPYRGPEPPPTGELQDSILALRSQVPPVLDVRTLLQRGLQARRAVLTVPWLVEFL    631 - 700
SFADHVVPLLEYYRDIFTLLLRLHRSLVLSQESEGKMCFLNKLLLLAVLGWLFQIPTVPEDLFFLEEGPS    701 - 770
YAFEVDTVAPEHGLDNAPVVDQQLLYTCCPYIGELRKLLASWVSGSSGRSGGFMRKITPTTTTSLGAQPS    771 - 840
QTSQGLQAQLAQAFFHNQPPSLRRTVEFVAERIGSNCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGD    841 - 910
PAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLATEKACAWLSAN    911 - 980
ITALIRREVKAAVSRTLRAQGPEPAARGERRGCSRACEHHAPLPSHLISEIKDVLSLAVGPRDPDEGVSP    981 - 1050
EHLEQLLGQLGQTLRCRQFLCPPAEQHLAKCSVELASLLVADQIPILGPPAQYRLERGQARRLLHMLLSL   1051 - 1120
WKEDFQGPVPLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAE   1121 - 1190
ELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS                                    1191 - 1227
//

Text Mined References (18)

PMID Year Title
24196372 2014 Congenital dyserythropoietic anemia in China: a case report from two families and a review.
23716552 2013 Homozygous mutations in a predicted endonuclease are a novel cause of congenital dyserythropoietic anemia type I.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22407294 2012 Codanin-1, mutated in the anaemic disease CDAI, regulates Asf1 function in S-phase histone supply.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21364188 2011 Codanin-1 mutations in congenital dyserythropoietic anemia type 1 affect HP1{alpha} localization in erythroblasts.
19336738 2009 Codanin-1, the protein encoded by the gene mutated in congenital dyserythropoietic anemia type I (CDAN1), is cell cycle-regulated.
18575862 2008 Congenital dyserythropoietic anemia in a Chinese family with a mutation of the CDAN1-gene.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18081704 2008 Congenital dyserythropoietic anaemia, type I, in a Caucasian patient with retinal angioid streaks (homozygous Arg1042Trp mutation in codanin-1).
More...