Property Summary

NCBI Gene PubMed Count 238
Grant Count 167
R01 Count 85
Funding $15,558,233.28
PubMed Score 295.59
PubTator Score 365.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IWU9 A6NGA4 Q14CB0
Symbols NTPH
ADHD7

Gene

PDB

4V06  

Gene RIF (295)

PMID Text
26583347 We also found that early family structure directly influences the levels of dysregulation problems in early adolescence, both alone and in interaction with TPH2.
26497913 loss of function mutation in Tph2 results in greater motivation for ethanol consumption under aversive conditions and may confer enhanced sensitivity to alcohol use disorder
26386440 Chinese Han individuals with at least oners11178997T allele or rs120074175A allele are susceptible to MD even in the relative absence of high-negative life events.
26232682 A potential role of TPH2 in alcohol dependencies suggested. TPH2 genetic variability may be also associated with anxiety and aggression traits in alcohol dependent subjects.
26071405 1,25-Dihydroxyvitamin D regulates expression of the tryptophan hydroxylase 2 and leptin genes: implication for behavioral influences of vitamin D.
26057341 TPH2 polymorphism may be associated with cognitive function in late onset depression patients.
26028568 results provide evidence for an association between the rs7305115 polymorphism of the TPH-2 gene and suicidal behavior in a Mexican population.
26013962 Study demonstrated that 5-HTTLPR, VNTR In2, and TPH2 rs1386497 polymorphisms mediate working memory performance and that their effects on working memory depend on cocaine use of participants
26001668 mood disorders and HTR1A G allele variation, the C-1019G polymorphism of the transcriptional control region of the 5-HT1A receptor, independently predicted the incidence of IFN-induced depression in HCV patients
25955598 TPH2 expression is regulated by DNA methylation of the TPH2 promoter region in patients with major depressive disorder.
More...

AA Sequence

MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATESGKTAVVFSL      1 - 70
KNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFNELIQLLKFQTTIVTLNPPEN     71 - 140
IWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRV    141 - 210
EYTEEETKTWGVVFRELSKLYPTHACREYLKNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAG    211 - 280
YLSPRDFLAGLAYRVFHCTQYIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDED    281 - 350
VQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF    351 - 420
VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDALNKMNQYLGI    421 - 490
//

Text Mined References (240)

PMID Year Title
26583347 2016 Effect of family structure and TPH2 G-703T on the stability of dysregulation profile throughout adolescence.
26497913 2015 Increased ethanol consumption despite taste aversion in mice with a human tryptophan hydroxylase 2 loss of function mutation.
26386440 2015 Interaction of tryptophan hydroxylase 2 gene and life events in susceptibility to major depression in a Chinese Han population.
26232682 2015 Genetic variability in tryptophan hydroxylase 2 gene in alcohol dependence and alcohol-related psychopathological symptoms.
26071405 2015 1,25-Dihydroxyvitamin D regulates expression of the tryptophan hydroxylase 2 and leptin genes: implication for behavioral influences of vitamin D.
26057341 2015 Tryptophan hydroxylase 2 gene is associated with cognition in late-onset depression in a Chinese Han population.
26028568 2015 Association analysis of TPH-1 and TPH-2 genes with suicidal behavior in patients with attempted suicide in Mexican population.
26013962 2015 Serotonin Transporter and Tryptophan Hydroxylase Gene Variations Mediate Working Memory Deficits of Cocaine Users.
26001668 2015 Serotonin gene polymorphisms and lifetime mood disorders in predicting interferon-induced depression in chronic hepatitis C.
25955598 2015 Methylation of the tryptophan hydroxylase?2 gene is associated with mRNA expression in patients with major depression with suicide attempts.
More...