Property Summary

NCBI Gene PubMed Count 9
PubMed Score 223.78
PubTator Score 26.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Precancerous Conditions 80 0.0 0.0
Disease Target Count Z-score Confidence
Syringomyelia 15 4.439 2.2
Glomangioma 3 4.118 2.1
Cardiac arrest 36 3.52 1.8
Scoliosis 44 3.383 1.7

Expression

Gene RIF (3)

AA Sequence

MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTV      1 - 70
EPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGWGEEFSLSKHPQG     71 - 140
TEVKAITYSAMQVYNEENPEVFVIIDI                                               141 - 167
//

Text Mined References (14)

PMID Year Title