Property Summary

NCBI Gene PubMed Count 9
Grant Count 146
R01 Count 24
Funding $51,770,927.06
PubMed Score 214.37
PubTator Score 26.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q8IWT0 Q5TGK5 Q6PDA1 Q8IWS9 Q8NEV6 Q8NEV7
Symbols ARCH
ARCH2

Gene

Gene RIF (3)

PMID Text
26648538 ARCH mutation is associated with chronic myelomonocytic leukemia.
25378478 RTCB, the catalytic subunit of the tRNA ligase complex, and its co-factor archease mediate XBP1 mRNA splicing both in vitro and in vivo.
24870230 archease (also called ZBTB8OS), a protein of unknown function, is required for full activity of the human tRNA ligase complex and, in cooperation with DDX1, facilitates the formation of an RTCB-guanylate intermediate central to mammalian RNA ligation

AA Sequence

MAQEEEDVRDYNLTEEQKAIKAKYPPVNRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTV      1 - 70
EPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGWGEEFSLSKHPQG     71 - 140
TEVKAITYSAMQVYNEENPEVFVIIDI                                               141 - 167
//

Text Mined References (14)

PMID Year Title
26648538 2016 Age-related mutations and chronic myelomonocytic leukemia.
25378478 2014 The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells.
24870230 2014 Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15162483 2004 Predicted role for the archease protein family based on structural and sequence analysis of TM1083 and MTH1598, two proteins structurally characterized through structural genomics efforts.
More...