Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
R01 Count 2
Funding $99,602.28
PubMed Score 8.71
PubTator Score 3.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IWR1 A8K5G9 D3DNL9
Symbols MRF1
TSBF1
IFT80L
RNF104
TRIM57

Gene

 Grant Application (2)

 GO Function (1)

Gene RIF (4)

PMID Text
26599082 we knocked down TRIM59 and found that p53 protein expression levels did not upregulate, so we proposed that TRIM59 may promote NSCLC cell growth through other pathways but not the p53 signaling pathway
25046164 TRIM59 interacts with P53, promoting its ubiquitination and degradation, and TRIM59 might promote gastric carcinogenesis via this mechanism.
22588174 These findings indicate that TRIM59 may serve as a multifunctional regulator for innate immune signaling pathways.
12095697 PMID:12095697 pertains to mouse Mrf1 gene which appears to be the homolog of human TSBF1.

AA Sequence

MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENILQASGNFYIWRPLRIPLKCPNCRSITEIAPTGI      1 - 70
ESLPVNFALRAIIEKYQQEDHPDIVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLK     71 - 140
EKDTPQKLLEQLTDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCDV    141 - 210
GNLINQEYTPQIERMKEIREQQLELMALTISLQEESPLKFLEKVDDVRQHVQILKQRPLPEVQPVEIYPR    211 - 280
VSKILKEEWSRTEIGQIKNVLIPKMKISPKRMSCSWPGKDEKEVEFLKILNIVVVTLISVILMSILFFNQ    281 - 350
HIITFLSEITLIWFSEASLSVYQSLSNSLHKVKNILCHIFYLLKEFVWKIVSH                     351 - 403
//

Text Mined References (10)

PMID Year Title
26599082 2015 TRIM59 Promotes the Proliferation and Migration of Non-Small Cell Lung Cancer Cells by Upregulating Cell Cycle Related Proteins.
25416956 2014 A proteome-scale map of the human interactome network.
25046164 2014 TRIM59 is up-regulated in gastric tumors, promoting ubiquitination and degradation of p53.
22588174 2012 TRIM59 interacts with ECSIT and negatively regulates NF-?B and IRF-3/7-mediated signal pathways.
18601909 2008 Identification and characterization of a long isoform of human IFT80, IFT80-L.
15941852 2005 Modulator recognition factor 1, an AT-rich interaction domain family member, is a novel corepressor for estrogen receptor alpha.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095697 2002 Molecular cloning, mapping and characterization of a novel mouse RING finger gene, Mrf1.