Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.34
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
osteosarcoma -1.595 0.000
medulloblastoma, large-cell 1.300 0.000
non-small cell lung cancer 1.128 0.000
group 4 medulloblastoma 1.100 0.003
Breast cancer 1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q8IWF2 B2RDI4 Q8N378 Q96BD1 Q9H5L5 Q9H6M8
Symbols ERFAD

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
24632291 Expression of FOXRED2 increases activity of hypoxia-targeted prodrugs.
19706418 ERFAD facilitates the dislocation of certain endoplasmic reticulum-associated degradation substrates to the cytosol.

AA Sequence

MGLSAAAPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSFFT      1 - 70
RYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGLRV     71 - 140
QYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLFVATGLSVPNQVDFPGSEYAEGYESVSVDPED    141 - 210
FVGQNVLILGRGNSAFETAENILGVTNFIHMLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLE    211 - 280
SDLTDLAILKDSKGKFHVTPKFFLEEANTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNK    281 - 350
SLRLNSGNAFGKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSV    351 - 420
TWPATELPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQLETLTGRKAKH    421 - 490
GLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRYLPTEQEVRFRPAHWPLPRPTAI    491 - 560
HHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAESCFLFALTRQKLPPFCQQGYLRMQGLVSTES    561 - 630
LWQHRVESRLLRDYAPTGRRLEDSSQQLGDQEPLGSPLAPGPLAQSVDSNKEEL                    631 - 684
//

Text Mined References (12)

PMID Year Title
24632291 2014 The flavoprotein FOXRED2 reductively activates nitro-chloromethylbenzindolines and other hypoxia-targeting prodrugs.
21359175 2011 Identification of the PDI-family member ERp90 as an interaction partner of ERFAD.
19706418 2009 A luminal flavoprotein in endoplasmic reticulum-associated degradation.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...