Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.34
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.100 9.9e-12
group 4 medulloblastoma 1.100 2.8e-03
malignant mesothelioma 1.200 7.6e-06
medulloblastoma, large-cell 1.300 4.6e-05
non-small cell lung cancer 1.034 6.5e-14
osteosarcoma 1.022 1.9e-03
ovarian cancer 1.200 3.7e-10

Gene RIF (2)

AA Sequence

MGLSAAAPLWGPPGLLLAIALHPALSVPPRRDYCVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSFFT      1 - 70
RYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGLRV     71 - 140
QYNTTIAHVTLDKDRQAWNGHYFILTDQKGQVHQCSVLFVATGLSVPNQVDFPGSEYAEGYESVSVDPED    141 - 210
FVGQNVLILGRGNSAFETAENILGVTNFIHMLSRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLE    211 - 280
SDLTDLAILKDSKGKFHVTPKFFLEEANTNQSADSITLPQDDNDNFAMRVPYDRVIRCLGWNFDFSIFNK    281 - 350
SLRLNSGNAFGKKYPLIRASYESKGSRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHSV    351 - 420
TWPATELPITQLTSSIVRRVNEASGLYQMFGVLADVILLKENSTAFEYLEEFPIQMLAQLETLTGRKAKH    421 - 490
GLFVINMEYGRNFSGPDKDVFFDDRSVGHTEDAWQSNFLHPVIYYYRYLPTEQEVRFRPAHWPLPRPTAI    491 - 560
HHIVEDFLTDWTAPIGHILPLRRFLENCLDTDLRSFYAESCFLFALTRQKLPPFCQQGYLRMQGLVSTES    561 - 630
LWQHRVESRLLRDYAPTGRRLEDSSQQLGDQEPLGSPLAPGPLAQSVDSNKEEL                    631 - 684
//

Text Mined References (12)

PMID Year Title