Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.58
PubTator Score 4.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.291 0.000
tuberculosis -1.700 0.000
psoriasis 1.200 0.000
ductal carcinoma in situ -1.100 0.001
invasive ductal carcinoma -1.400 0.002

Synonym

Accession Q8IWE4 B3KVY4
Symbols 44M2.4
SCCRO3

Gene

PDB

4GBA  

Gene RIF (2)

PMID Text
25349211 SCCRO3 functions as a tumor suppressor by antagonizing the neddylation activity of SCCRO
18823379 DCUN1D3 is a novel UVC-response gene involved in cell cycle regulation and cell survival.

AA Sequence

MGQCVTKCKNPSSTLGSKNGDREPSNKSHSRRGAGHREEQVPPCGKPGGDILVNGTKKAEAATEACQLPT      1 - 70
SSGDAGRESKSNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMC     71 - 140
KFTRKEFFDGCKAISADSIDGICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWK    141 - 210
LVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMER    211 - 280
RKREGEGRGALSSGPEGLCPEEQT                                                  281 - 304
//

Text Mined References (10)

PMID Year Title
25349211 2014 SCCRO3 (DCUN1D3) antagonizes the neddylation and oncogenic activity of SCCRO (DCUN1D1).
23201271 2013 Structural conservation of distinctive N-terminal acetylation-dependent interactions across a family of mammalian NEDD8 ligation enzymes.
18823379 2008 DCUN1D3, a novel UVC-responsive gene that is involved in cell cycle progression and cell growth.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15988528 2005 The conserved protein DCN-1/Dcn1p is required for cullin neddylation in C. elegans and S. cerevisiae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.