Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.17
PubTator Score 1.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 4.6e-40
osteosarcoma 7950 6.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.6
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.172 6.4e-05
psoriasis 3.200 4.6e-40

AA Sequence

MTKVPATKKLQSSPNSGAVRPFYASENLRQVPDKPMKSIKYMDKEIINLKKDLIRSRFLIQSVKIGRGYF      1 - 70
AILREETAKKKKQQQLQKLKEEERNKFQPAEKISEIHYGDTLLSTYDDEKLKTLGARVTRRPFTPIHSCI     71 - 140
ISPSLTEAHVEPLFRQLCALHWLLEALTIDHTHHTMKPVITCWNPKDPGGSKSTIKKINKDKSMGQKWEH    141 - 210
FITAPKTKKFKIPTMRVTNRKPSRRGSTLSLSRASGGSSPQSSMISVNPGSDEPPSVNTQVTSSKDIEDN    211 - 280
ESSSTKPDEEPLYMNLQKLLEMVREDARRTVTIENGMQRKAPSILSVLKQNKSNSAYKEMQTTLKSSERS    281 - 350
SSTSAESHIQPVQKKSKNRTNCDINIHYKSGVCNTMRAKFYSVAQEAGFCLQDKMEILMKRQEERGIQKF    351 - 420
RAFVLVSNFQKDIAKMRHHISVVKGDAEEIADHWYFDLLSKLPEDLKNFRPAKKILVKLQKFGENLDLRI    421 - 490
RPHVLLKVLQDLRIWELCSPDIAVAIEFVREHIIHMPQEDYISWLQSRINIPIGPYSALR              491 - 550
//

Text Mined References (8)

PMID Year Title