Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 1.3e-26
ovarian cancer 8520 2.4e-07
dermatomyositis 966 2.1e-04
psoriasis 6694 6.1e-04

Expression

  Differential Expression (4)

Disease log2 FC p
dermatomyositis 1.100 2.1e-04
lung carcinoma 1.200 1.3e-26
ovarian cancer -1.900 2.4e-07
psoriasis 1.100 6.1e-04

Gene RIF (3)

AA Sequence

MVTRAGAGTAVAGAVVVALLSAALALYGPPLDAVLERAFSLRKAHSIKDMENTLQLVRNIIPPLSSTKHK      1 - 70
GQDGRIGVVGGCQEYTGAPYFAAISALKVGADLSHVFCASAAAPVIKAYSPELIVHPVLDSPNAVHEVEK     71 - 140
WLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEF    141 - 210
SRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQKGERDILSNGQQVLVCSQEGSSRRCGGQGDLLSGS    211 - 280
LGVLVHWALLAGPQKTNGSSPLLVAAFGACSLTRQCNHQAFQKHGRSTTTSDMIAEVGAAFSKLFET       281 - 347
//

Text Mined References (15)

PMID Year Title