Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.15
PubTator Score 1.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
systemic lupus erythematosus 1.100 0.000
psoriasis 3.400 0.000
cutaneous lupus erythematosus 3.300 0.000
medulloblastoma -2.300 0.000
cystic fibrosis 2.108 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -2.800 0.000
juvenile dermatomyositis 2.902 0.000
Atopic dermatitis 1.500 0.003
intraductal papillary-mucinous neoplasm ... 1.900 0.005
lung cancer -3.800 0.000
primary Sjogren syndrome 1.900 0.000
ovarian cancer -1.700 0.000
dermatomyositis 1.700 0.028

Gene RIF (2)

PMID Text
19460752 Knockdown of HECT and RLD domain containing E3 ubiquitin protein ligase family member 6 (HERC6) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15676274 HERC6 ancestor emerged in nematodes and that the family expanded throughout evolution. The mRNA expression pattern was found to be diverse in selected tissues and cells

AA Sequence

MYFCWGADSRELQRRRTAGSPGAELLQAASGERHSLLLLTNHRVLSCGDNSRGQLGRRGAQRGELPEPIQ      1 - 70
ALETLIVDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTPKKIMTLNDIKIIQVSCGHYHS     71 - 140
LALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLCGTSFGWGSNSA    141 - 210
GQLALSGRNVPVQSNKPLSVGALKNLGVVYISCGDAHTAVLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQ    211 - 280
LVERIDGLVSQIDCGSYHTLAYVHTTGQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKH    281 - 350
IFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSMAEKWIAVKRRSTEHEMAKSEIRMIFSSPACLTAS    351 - 420
FLKKRGTGETTSIDVDLEMARDTFKKLTKKEWISSMITTCLEDDLLRALPCHSPHQEALSVFLLLPECPV    421 - 490
MHDSKNWKNLVVPFAKAVCEMSKQSLQVLKKCWAFLQESSLNPLIQMLKAAIISQLLHQTKTEQDHCNVK    491 - 560
ALLGMMKELHKVNKANCRLPENTFNINELSNLLNFYIDRGRQLFRDNHLIPAETPSPVIFSDFPFIFNSL    561 - 630
SKIKLLQADSHIKMQMSEKKAYMLMHETILQKKDEFPPSPRFILRVRRSRLVKDALRQLSQAEATDFCKV    631 - 700
LVVEFINEICPESGGVSSEFFHCMFEEMTKPEYGMFMYPEMGSCMWFPAKPKPEKKRYFLFGMLCGLSLF    701 - 770
NLNVANLPFPLALYKKLLDQKPSLEDLKELSPRLGKSLQEVLDDAADDIGDALCIRFSIHWDQNDVDLIP    771 - 840
NGISIPVDQTNKRDYVSKYIDYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPEELMTAIIGNTDYDWKQ    841 - 910
FEQNSKYEQGYQKSHPTIQLFWKAFHKLTLDEKKKFLFFLTGRDRLHARGIQKMEIVFRCPETFSERDHP    911 - 980
TSITCHNILSLPKYSTMERMEEALQVAINNNRGFVSPMLTQS                                981 - 1022
//

Text Mined References (10)

PMID Year Title
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15676274 2005 The human HERC family of ubiquitin ligases: novel members, genomic organization, expression profiling, and evolutionary aspects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.