Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.25
PubTator Score 1.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
lung cancer -2.300 2.4e-04
Atopic dermatitis 1.500 2.9e-03
atypical teratoid / rhabdoid tumor -1.700 3.4e-04
cutaneous lupus erythematosus 3.300 2.8e-05
cystic fibrosis 2.108 2.0e-04
dermatomyositis 1.700 2.8e-02
group 3 medulloblastoma -2.100 8.7e-04
intraductal papillary-mucinous neoplasm ... 1.900 4.5e-03
juvenile dermatomyositis 2.902 2.1e-17
medulloblastoma, large-cell -2.800 1.2e-04
ovarian cancer -1.700 1.7e-04
primary Sjogren syndrome 1.900 2.8e-04
psoriasis 2.800 4.6e-08
Systemic lupus erythematosus 1.100 1.9e-04

Gene RIF (2)

AA Sequence

MYFCWGADSRELQRRRTAGSPGAELLQAASGERHSLLLLTNHRVLSCGDNSRGQLGRRGAQRGELPEPIQ      1 - 70
ALETLIVDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTPKKIMTLNDIKIIQVSCGHYHS     71 - 140
LALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLCGTSFGWGSNSA    141 - 210
GQLALSGRNVPVQSNKPLSVGALKNLGVVYISCGDAHTAVLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQ    211 - 280
LVERIDGLVSQIDCGSYHTLAYVHTTGQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKH    281 - 350
IFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSMAEKWIAVKRRSTEHEMAKSEIRMIFSSPACLTAS    351 - 420
FLKKRGTGETTSIDVDLEMARDTFKKLTKKEWISSMITTCLEDDLLRALPCHSPHQEALSVFLLLPECPV    421 - 490
MHDSKNWKNLVVPFAKAVCEMSKQSLQVLKKCWAFLQESSLNPLIQMLKAAIISQLLHQTKTEQDHCNVK    491 - 560
ALLGMMKELHKVNKANCRLPENTFNINELSNLLNFYIDRGRQLFRDNHLIPAETPSPVIFSDFPFIFNSL    561 - 630
SKIKLLQADSHIKMQMSEKKAYMLMHETILQKKDEFPPSPRFILRVRRSRLVKDALRQLSQAEATDFCKV    631 - 700
LVVEFINEICPESGGVSSEFFHCMFEEMTKPEYGMFMYPEMGSCMWFPAKPKPEKKRYFLFGMLCGLSLF    701 - 770
NLNVANLPFPLALYKKLLDQKPSLEDLKELSPRLGKSLQEVLDDAADDIGDALCIRFSIHWDQNDVDLIP    771 - 840
NGISIPVDQTNKRDYVSKYIDYIFNVSVKAVYEEFQRGFYRVCEKEILRHFYPEELMTAIIGNTDYDWKQ    841 - 910
FEQNSKYEQGYQKSHPTIQLFWKAFHKLTLDEKKKFLFFLTGRDRLHARGIQKMEIVFRCPETFSERDHP    911 - 980
TSITCHNILSLPKYSTMERMEEALQVAINNNRGFVSPMLTQS                                981 - 1022
//

Text Mined References (10)

PMID Year Title