Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.04
PubTator Score 3.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

AA Sequence

MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQK      1 - 70
VGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIV     71 - 140
ISSGFVGGFLLGLAS                                                           141 - 155
//

Text Mined References (20)

PMID Year Title