Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.18
PubTator Score 3.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8IVP5
Symbols

Gene

Gene RIF (3)

PMID Text
25126723 The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy.
24671035 FUNDC1 regulates ULK1 recruitment to damaged mitochondria, where FUNDC1 phosphorylation by ULK1 is crucial for mitophagy.
22267086 Data show that Knockdown of endogenous FUNDC1 significantly prevented hypoxia-induced mitophagy, which could be reversed by the expression of wild-type FUNDC1.

AA Sequence

MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQK      1 - 70
VGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATEFIKQNIV     71 - 140
ISSGFVGGFLLGLAS                                                           141 - 155
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25126723 2014 The BCL2L1 and PGAM5 axis defines hypoxia-induced receptor-mediated mitophagy.
24700572 2014 A novel EBP c.224T>A mutation supports the existence of a male-specific disorder independent of CDPX2.
24671035 2014 ULK1 translocates to mitochondria and phosphorylates FUNDC1 to regulate mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22267086 2012 Mitochondrial outer-membrane protein FUNDC1 mediates hypoxia-induced mitophagy in mammalian cells.
20562859 2010 Network organization of the human autophagy system.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18957941 2010 Genome-wide association scan for five major dimensions of personality.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...