Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.24
PubTator Score 0.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -2.800 0.000
posterior fossa group A ependymoma 2.400 0.000
sonic hedgehog group medulloblastoma 3.200 0.000
cystic fibrosis -7.561 0.000
glioblastoma 1.400 0.010
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer -1.431 0.000
active ulcerative colitis 1.450 0.021
fibroadenoma 1.900 0.004
lung adenocarcinoma -2.100 0.000
pediatric high grade glioma 1.200 0.004
inflammatory breast cancer -2.400 0.006
lung carcinoma -1.600 0.000
gastric carcinoma -2.000 0.050
ovarian cancer -5.100 0.000

AA Sequence

MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRAC      1 - 70
PARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHTYVPAF     71 - 140
ITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAM    141 - 210
NSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI                    211 - 264
//

Text Mined References (8)

PMID Year Title
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.