Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.96
PubTator Score 7.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 1.72781248112683E-34
Breast cancer 3099 3.34463800260026E-29
non-small cell lung cancer 2798 1.58662301408634E-21
astrocytoma 1493 8.69226715818742E-14
pilocytic astrocytoma 3086 6.23179058932708E-13
oligodendroglioma 2849 1.73129890700573E-12
glioblastoma 5572 8.21914672970704E-10
ovarian cancer 8492 1.02739032589807E-9
sonic hedgehog group medulloblastoma 1482 1.3920634905918E-9
pediatric high grade glioma 2712 5.57504017035427E-9
ependymoma 2514 6.37628981790845E-9
tuberculosis and treatment for 6 months 686 3.275562400118E-6
primitive neuroectodermal tumor 3031 3.2011011291941E-5
ductal carcinoma in situ 1745 1.25890617256868E-4
invasive ductal carcinoma 2950 1.56749420965923E-4
atypical teratoid / rhabdoid tumor 4369 1.71575256264857E-4
medulloblastoma, large-cell 6234 7.10501457078812E-4
primary pancreatic ductal adenocarcinoma 1271 0.00260164567648282
Rheumatoid Arthritis 1171 0.00903839152931395
aldosterone-producing adenoma 664 0.013318015257581
adrenocortical carcinoma 1427 0.0159875705140029
osteosarcoma 7933 0.0162499265023913
head and neck cancer 270 0.0295512000419232
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 3.669 1.8
Disease Target Count Z-score Confidence
Chromosome 3q29 microdeletion syndrome 8 4.735 2.4
Disease Target Count
Deafness, Autosomal Dominant 44 1
Disease Target Count
Deafness, autosomal dominant, 44 1

Expression

Synonym

Accession Q8IVM0 Q86VH7
Symbols YMER
C3orf6
DFNA44

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
22331027 Ymer acts as a regulator downstream of several receptors and that Ymer functions as a positive or negative regulator in a signaling pathway-dependent manner.
19641524 CCDC50 is required for survival in mantle cell lymphoma and chronic lymphocytic leukemia cells and controls NFkappaB signaling
19059208 These findings demonstrate that Ymer is likely to be a negative regulator for the NF-kappaB signaling pathway.
16803894 Ymer functions as a novel inhibitor for the down-regulation of the EGF receptor and plays a crucial role for regulating the amount of the EGF receptor on the cell surface membrane
12483295 identification of a novel DFNA locus on chromosome 3q28-29 in a Spanish family with postlingual and progressive hearing loss[DFNA44]

AA Sequence

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ      1 - 70
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY     71 - 140
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM    141 - 210
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT    211 - 280
HFTNQQSSTRHFSKSESSHKGFHYKH                                                281 - 306
//

Text Mined References (22)

PMID Year Title
23562540 2013 GWAS of cerebrospinal fluid tau levels identifies risk variants for Alzheimer's disease.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22331027 2012 Ymer acts as a multifunctional regulator in nuclear factor-?B and Fas signaling pathways.
21269460 2011 Initial characterization of the human central proteome.
19641524 2009 Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19059208 2009 Inhibition of NF-kappaB signaling via tyrosine phosphorylation of Ymer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...