Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.67
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adrenocortical carcinoma -1.051 1.6e-02
adult high grade glioma 1.200 1.4e-03
aldosterone-producing adenoma -1.272 1.3e-02
astrocytoma 1.200 8.7e-14
Astrocytoma, Pilocytic 1.900 5.0e-11
atypical teratoid / rhabdoid tumor 1.500 1.7e-04
Breast cancer -1.900 3.3e-29
breast carcinoma -1.200 4.5e-34
ductal carcinoma in situ -1.300 3.3e-04
ependymoma 1.100 3.5e-10
glioblastoma 1.300 8.2e-09
group 3 medulloblastoma 1.500 4.4e-05
head and neck cancer -1.100 3.0e-02
invasive ductal carcinoma -2.000 2.0e-04
medulloblastoma, large-cell 1.200 1.0e-03
non-small cell lung cancer -1.787 1.4e-21
oligodendroglioma 1.200 2.3e-02
osteosarcoma 1.372 1.6e-02
ovarian cancer -1.400 5.3e-06
primary pancreatic ductal adenocarcinoma 1.214 2.6e-03
primitive neuroectodermal tumor 1.600 2.2e-05
Rheumatoid arthritis 1.700 9.0e-03
tuberculosis and treatment for 6 months 1.400 3.3e-06

Gene RIF (6)

AA Sequence

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ      1 - 70
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY     71 - 140
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM    141 - 210
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT    211 - 280
HFTNQQSSTRHFSKSESSHKGFHYKH                                                281 - 306
//

Text Mined References (23)

PMID Year Title