Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.96
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
22331027 Ymer acts as a regulator downstream of several receptors and that Ymer functions as a positive or negative regulator in a signaling pathway-dependent manner.
19641524 CCDC50 is required for survival in mantle cell lymphoma and chronic lymphocytic leukemia cells and controls NFkappaB signaling
19059208 These findings demonstrate that Ymer is likely to be a negative regulator for the NF-kappaB signaling pathway.
16803894 Ymer functions as a novel inhibitor for the down-regulation of the EGF receptor and plays a crucial role for regulating the amount of the EGF receptor on the cell surface membrane
12483295 identification of a novel DFNA locus on chromosome 3q28-29 in a Spanish family with postlingual and progressive hearing loss[DFNA44]

AA Sequence

MAEVSIDQSKLPGVKEVCRDFAVLEDHTLAHSLQEQEIEHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQ      1 - 70
AQLQKRYKDLEQQDCEIAQEIQEKLAIEAERRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEFPATRAY     71 - 140
ADSYYYEDGGMKPRVMKEAVSTPSRMAHRDQEWYDAEIARKLQEEELLATQVDMRAAQVAQDEEIARLLM    141 - 210
AEEKKAYKKAKEREKSSLDKRKQDPEWKPKTAKAANSKSKESDEPHHSKNERPARPPPPIMTDGEDADYT    211 - 280
HFTNQQSSTRHFSKSESSHKGFHYKH                                                281 - 306
//

Text Mined References (22)

PMID Year Title
23562540 2013 GWAS of cerebrospinal fluid tau levels identifies risk variants for Alzheimer's disease.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22331027 2012 Ymer acts as a multifunctional regulator in nuclear factor-?B and Fas signaling pathways.
21269460 2011 Initial characterization of the human central proteome.
19641524 2009 Gene knockdown studies revealed CCDC50 as a candidate gene in mantle cell lymphoma and chronic lymphocytic leukemia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19059208 2009 Inhibition of NF-kappaB signaling via tyrosine phosphorylation of Ymer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...