Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Muir-Torre syndrome 4 3.41 1.7

Expression

Gene RIF (1)

AA Sequence

MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPL      1 - 70
DLWTQGKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDGLKRGRGCNGAAHLVRGDAWK     71 - 140
TKLGEPWVSIALALAGPGAILILELSWFLG                                            141 - 170
//

Text Mined References (8)

PMID Year Title