Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.95
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Muir-Torre syndrome 1 3.431 1.7

Gene RIF (1)

PMID Text
16187228 There is a trend for APRG1 transcription to be low in malignant tissues and lower still in those patients who develop progressive disease, also between gr I and gr III tumors. Results suggestive of APRG1 acting as a tumour suppressor gene.

AA Sequence

MKTMATRKRCKLSRTGPEFENVIKRLLCARTFHTRIGGDLTHGIINRGRRANAEQMGLQGSAQHFNIFPL      1 - 70
DLWTQGKKTEVQKREGTDSIPAAGRSGTANQPSIAPHRCLFSRGITALDGLKRGRGCNGAAHLVRGDAWK     71 - 140
TKLGEPWVSIALALAGPGAILILELSWFLG                                            141 - 170
//

Text Mined References (8)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16187228 2005 Evidence for a tumour suppressive function of APRG1 in breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208675 2004 Discovery of frequent homozygous deletions in chromosome 3p21.3 LUCA and AP20 regions in renal, lung and breast carcinomas.
12771950 2003 Deletion mapping using quantitative real-time PCR identifies two distinct 3p21.3 regions affected in most cervical carcinomas.
12543795 2003 An integrated physical and gene map of the 3.5-Mb chromosome 3p21.3 (AP20) region implicated in major human epithelial malignancies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.