Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.07
PubTator Score 13.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 9.7e-03
Breast cancer -1.900 8.5e-05
invasive ductal carcinoma -2.100 1.7e-03
lung adenocarcinoma -1.400 6.4e-10
lung carcinoma -2.400 2.2e-14
non-small cell lung cancer -3.626 2.5e-39
osteosarcoma -3.048 1.4e-04
psoriasis -1.400 6.3e-08

 GO Function (1)

Gene RIF (14)

AA Sequence

MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS      1 - 70
AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL     71 - 140
MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ    141 - 210
SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL    211 - 280
LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD    281 - 350
ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS    351 - 420
GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAA    421 - 490
YVEELPSNAGNTATKA                                                          491 - 506
//

Text Mined References (27)

PMID Year Title