Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 4
Funding $124,560.78
PubMed Score 13.40
PubTator Score 13.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.100 0.010
osteosarcoma -3.048 0.000
non-small cell lung cancer -3.626 0.000
lung adenocarcinoma -2.600 0.000
psoriasis -1.400 0.000
inflammatory breast cancer -1.900 0.008
lung carcinoma -2.400 0.000
invasive ductal carcinoma -2.100 0.002

Synonym

Accession Q8IVI9 A8K2I9 B3KSF5 E7EPT9 Q27HG3 Q53S62 Q96CJ9
Symbols DaIP2

Gene

PANTHER Protein Class (1)

PDB

2YUN  

 GO Function (1)

Gene RIF (12)

PMID Text
24588201 no significant difference in serum level associated with preeclampsia or intrauterine growth restriction
23592143 This study showed that overexpression of NOSTRIN had a significant effect on eNOS activity in HUVECs and resulted in significant cellular damage.
21351530 The expression of NOSTRIN is decreased, while the activity of eNOS and the level of NO2-/NO3- increased in the testis tissue of azoospermia patients.
21183735 Results reveal an elegant mechanism of eNOS regulation by PECAM-1 through signal transducers and activators of transcription 3-mediated transcriptional control of NOSTRIN.
20442744 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
19399414 NOSTRIN expression was increased in umbilical vessel of women with pre-eclampsia.
18980613 results suggest that nuclear NOSTRINbeta may negatively regulate transcription of the NOSTRIN gene
16807357 A ternary complex between NOSTRIN, caveolin-1, and eNOS mediates translocation of eNOS, with important implications for the activity and availability of eNOS in the cell.
More...

AA Sequence

MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKALQNTRKSCVSS      1 - 70
AWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVEKTANLVISNWNQQIKAKKKL     71 - 140
MVSTKKHEALFQLVESSKQSMTEKEKRKLLNKLTKSTEKLEKEDENYYQKNMAGYSTRLKWENTLENCYQ    141 - 210
SILELEKERIQLLCNNLNQYSQHISLFGQTLTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFL    211 - 280
LTDYFEEDPNSAMDKERRKSLLKPKLLRLQRDIEKASKDKEGLERMLKTYSSTSSFSDAKSQKDTAALMD    281 - 350
ENNLKLDLLEANSYKLSSMLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLENIVSKASS    351 - 420
GGQSNPGSSTPAPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEGGWWFGSLNGKKGHFPAA    421 - 490
YVEELPSNAGNTATKA                                                          491 - 506
//

Text Mined References (25)

PMID Year Title
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
24588201 2015 The relation of maternal serum eNOS, NOSTRIN and ADMA levels with aetiopathogenesis of preeclampsia and/or intrauterine fetal growth restriction.
23592143 2013 Changes in human umbilical vein endothelial cells induced by endothelial nitric oxide synthase traffic inducer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22751148 2012 The F-BAR protein NOSTRIN participates in FGF signal transduction and vascular development.
21351530 2011 [Expression of NOSTRIN in the testis tissue of azoospermia patients].
21183735 2011 Platelet-endothelial cell adhesion molecule-1 regulates endothelial NO synthase activity and localization through signal transducers and activators of transcription 3-dependent NOSTRIN expression.
20442744 2010 Linkage and candidate gene studies of autism spectrum disorders in European populations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
More...