Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.70
PubTator Score 6.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 2.85764861664007E-32
non-small cell lung cancer 2798 4.43539721613902E-14
juvenile dermatomyositis 1189 1.10815672941449E-11
posterior fossa group A ependymoma 1511 2.80899125888225E-11
ulcerative colitis 2087 1.3890559830741E-9
astrocytoma 1493 2.74210155664957E-7
primary Sjogren syndrome 789 1.02825766467711E-6
adult high grade glioma 2148 3.06764374766029E-5
pilocytic astrocytoma 3086 3.12236752015592E-5
glioblastoma 5572 3.94852482447686E-4
ovarian cancer 8492 4.84312384791169E-4
pancreatic cancer 2300 6.56911612171041E-4
tuberculosis 1563 7.35700171058071E-4
active Crohn's disease 918 0.00123151567907886
osteosarcoma 7933 0.00158748608382836
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00459250218839497
Multiple Sclerosis 498 0.00524856356556
interstitial cystitis 2299 0.0105758962313633
cystic fibrosis 1670 0.0124612242964785
hepatocellular carcinoma 550 0.0152277038866297
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0221289110898591
subependymal giant cell astrocytoma 2287 0.0279887291294851
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0382977942033488
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0453449084103797
urothelial carcinoma 318 0.0472008349585245
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Connective tissue disease 59 0.0 2.0
Disease Target Count
Ataxia-pancytopenia syndrome 1

Expression

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG

Gene RIF (1)

PMID Text
25076857 The findings highlight a novel tumor-suppressive role of SAMD9L inactivation by somatic mutation and decreased expression in human HBV-related HCC

AA Sequence

MSKQVSLPEMIKDWTKEHVKKWVNEDLKINEQYGQILLSEEVTGLVLQELTEKDLVEMGLPWGPALLIKR      1 - 70
SYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMSSNIDYDPREIRDIKQEESILMKEN     71 - 140
VLDEVANAKHKKKGKLKPEQLTCMPYPFDQFHDSHRYIEHYTLQPETGALNLIDPIHEFKALTNTETATE    141 - 210
VDIKMKFSNEVFRFASACMNSRTNGTIHFGVKDKPHGEIVGVKITSKAAFIDHFNVMIKKYFEESEINEA    211 - 280
KKCIREPRFVEVLLQNNTPSDRFVIEVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSR    281 - 350
DILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLLIGNRDSLDNSYYDWYILV    351 - 420
TNKCHPNQIKHLDFLKEIKWFAVLEFDPESMINGVVKAYKESRVANLHFPNQYEDKTTNMWEKISTLNLY    421 - 490
QQPSWIFCNGRSDLKSETYKPLEPHLWQRERASEVRKLILFLTDENIMTRGKFLVVFLLLSSVESPGDPL    491 - 560
IETFWAFYQALKGMENMLCISVNSHIYQRWKDLLQTRMKMEDELTNHSISTLNIELVNSTILKLKSVTRS    561 - 630
SRRFLPARGSSSVILEKKKEDVLTALEILCENECTETDIEKDKSKFLEFKKSKEEHFYRGGKVSWWNFYF    631 - 700
SSENYSSDFVKRDSYEKLKDLIHCWAESPKPIFAKIINLYHHPGCGGTTLAMHVLWDLKKNFRCAVLKNK    701 - 770
TTDFAEIAEQVINLVTYRAKSHQDYIPVLLLVDDFEEQENVYFLQNAIHSVLAEKDLRYEKTLVIILNCM    771 - 840
RSRNPDESAKLADSIALNYQLSSKEQRAFGAKLKEIEKQHKNCENFYSFMIMKSNFDETYIENVVRNILK    841 - 910
GQDVDSKEAQLISFLALLSSYVTDSTISVSQCEIFLGIIYTSTPWEPESLEDKMGTYSTLLIKTEVAEYG    911 - 980
RYTGVRIIHPLIALYCLKELERSYHLDKCQIALNILEENLFYDSGIGRDKFQHDVQTLLLTRQRKVYGDE    981 - 1050
TDTLFSPLMEALQNKDIEKVLSAGSRRFPQNAFICQALARHFYIKEKDFNTALDWARQAKMKAPKNSYIS   1051 - 1120
DTLGQVYKSEIKWWLDGNKNCRSITVNDLTHLLEAAEKASRAFKESQRQTDSKNYETENWSPQKSQRRYD   1121 - 1190
MYNTACFLGEIEVGLYTIQILQLTPFFHKENELSKKHMVQFLSGKWTIPPDPRNECYLALSKFTSHLKNL   1191 - 1260
QSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRK   1261 - 1330
KLEALRADRFAGLLEYLNPNYKDATTMESIVNEYAFLLQQNSKKPMTNEKQNSILANIILSCLKPNSKLI   1331 - 1400
QPLTTLKKQLREVLQFVGLSHQYPGPYFLACLLFWPENQELDQDSKLIEKYVSSLNRSFRGQYKRMCRSK   1401 - 1470
QASTLFYLGKRKGLNSIVHKAKIEQYFDKAQNTNSLWHSGDVWKKNEVKDLLRRLTGQAEGKLISVEYGT   1471 - 1540
EEKIKIPVISVYSGPLRSGRNIERVSFYLGFSIEGPLAYDIEVI                             1541 - 1584
//

Text Mined References (9)

PMID Year Title
25076857 2014 SAMD9L inactivation promotes cell proliferation via facilitating G1-S transition in hepatitis B virus-associated hepatocellular carcinoma.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
21269460 2011 Initial characterization of the human central proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17407603 2007 Human sterile alpha motif domain 9, a novel gene identified as down-regulated in aggressive fibromatosis, is absent in the mouse.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.