Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.77
PubTator Score 6.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease 2.056 1.2e-03
active ulcerative colitis 1.768 9.4e-03
adult high grade glioma 1.700 4.1e-04
astrocytoma 1.100 2.7e-07
Astrocytoma, Pilocytic 1.200 5.2e-05
cystic fibrosis 1.600 1.2e-02
ependymoma 1.900 1.0e-12
glioblastoma 1.600 1.4e-04
hepatocellular carcinoma 1.200 1.5e-02
interstitial cystitis 1.500 1.1e-02
intraductal papillary-mucinous adenoma (... 1.100 2.2e-02
intraductal papillary-mucinous carcinoma... 1.200 4.5e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.5e-02
juvenile dermatomyositis 2.350 1.1e-11
lung carcinoma -3.400 2.9e-32
Multiple Sclerosis 1.900 5.2e-03
non-small cell lung cancer -1.036 4.0e-08
osteosarcoma -1.424 1.8e-02
ovarian cancer 1.300 3.8e-03
pancreatic cancer 1.100 6.6e-04
pancreatic ductal adenocarcinoma liver m... 1.041 3.8e-02
primary Sjogren syndrome 2.800 1.0e-06
subependymal giant cell astrocytoma 2.494 9.8e-03
tuberculosis 1.700 7.8e-03
urothelial carcinoma -1.800 4.7e-02

Gene RIF (3)

AA Sequence

MSKQVSLPEMIKDWTKEHVKKWVNEDLKINEQYGQILLSEEVTGLVLQELTEKDLVEMGLPWGPALLIKR      1 - 70
SYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMSSNIDYDPREIRDIKQEESILMKEN     71 - 140
VLDEVANAKHKKKGKLKPEQLTCMPYPFDQFHDSHRYIEHYTLQPETGALNLIDPIHEFKALTNTETATE    141 - 210
VDIKMKFSNEVFRFASACMNSRTNGTIHFGVKDKPHGEIVGVKITSKAAFIDHFNVMIKKYFEESEINEA    211 - 280
KKCIREPRFVEVLLQNNTPSDRFVIEVDTIPKHSICNDKYFYIQMQICKDKIWKQNQNLSLFVREGASSR    281 - 350
DILANSKQRDVDFKAFLQNLKSLVASRKEAEEEYGMKAMKKESEGLKLVKLLIGNRDSLDNSYYDWYILV    351 - 420
TNKCHPNQIKHLDFLKEIKWFAVLEFDPESMINGVVKAYKESRVANLHFPNQYEDKTTNMWEKISTLNLY    421 - 490
QQPSWIFCNGRSDLKSETYKPLEPHLWQRERASEVRKLILFLTDENIMTRGKFLVVFLLLSSVESPGDPL    491 - 560
IETFWAFYQALKGMENMLCISVNSHIYQRWKDLLQTRMKMEDELTNHSISTLNIELVNSTILKLKSVTRS    561 - 630
SRRFLPARGSSSVILEKKKEDVLTALEILCENECTETDIEKDKSKFLEFKKSKEEHFYRGGKVSWWNFYF    631 - 700
SSENYSSDFVKRDSYEKLKDLIHCWAESPKPIFAKIINLYHHPGCGGTTLAMHVLWDLKKNFRCAVLKNK    701 - 770
TTDFAEIAEQVINLVTYRAKSHQDYIPVLLLVDDFEEQENVYFLQNAIHSVLAEKDLRYEKTLVIILNCM    771 - 840
RSRNPDESAKLADSIALNYQLSSKEQRAFGAKLKEIEKQHKNCENFYSFMIMKSNFDETYIENVVRNILK    841 - 910
GQDVDSKEAQLISFLALLSSYVTDSTISVSQCEIFLGIIYTSTPWEPESLEDKMGTYSTLLIKTEVAEYG    911 - 980
RYTGVRIIHPLIALYCLKELERSYHLDKCQIALNILEENLFYDSGIGRDKFQHDVQTLLLTRQRKVYGDE    981 - 1050
TDTLFSPLMEALQNKDIEKVLSAGSRRFPQNAFICQALARHFYIKEKDFNTALDWARQAKMKAPKNSYIS   1051 - 1120
DTLGQVYKSEIKWWLDGNKNCRSITVNDLTHLLEAAEKASRAFKESQRQTDSKNYETENWSPQKSQRRYD   1121 - 1190
MYNTACFLGEIEVGLYTIQILQLTPFFHKENELSKKHMVQFLSGKWTIPPDPRNECYLALSKFTSHLKNL   1191 - 1260
QSDLKRCFDFFIDYMVLLKMRYTQKEIAEIMLSKKVSRCFRKYTELFCHLDPCLLQSKESQLLQEENCRK   1261 - 1330
KLEALRADRFAGLLEYLNPNYKDATTMESIVNEYAFLLQQNSKKPMTNEKQNSILANIILSCLKPNSKLI   1331 - 1400
QPLTTLKKQLREVLQFVGLSHQYPGPYFLACLLFWPENQELDQDSKLIEKYVSSLNRSFRGQYKRMCRSK   1401 - 1470
QASTLFYLGKRKGLNSIVHKAKIEQYFDKAQNTNSLWHSGDVWKKNEVKDLLRRLTGQAEGKLISVEYGT   1471 - 1540
EEKIKIPVISVYSGPLRSGRNIERVSFYLGFSIEGPLAYDIEVI                             1541 - 1584
//

Text Mined References (15)

PMID Year Title