Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.28
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.200 0.013
osteosarcoma 1.578 0.021
glioblastoma 1.800 0.000
non-small cell lung cancer -2.889 0.000
intraductal papillary-mucinous adenoma (... 1.700 0.002
intraductal papillary-mucinous carcinoma... 1.800 0.008
Breast cancer -3.100 0.043
interstitial cystitis -1.200 0.013
lung adenocarcinoma -1.800 0.000
pediatric high grade glioma 1.500 0.002
group 4 medulloblastoma -1.200 0.001
pilocytic astrocytoma 2.800 0.000
invasive ductal carcinoma -2.300 0.000
lung carcinoma -2.900 0.000
breast carcinoma -1.300 0.000
ductal carcinoma in situ -1.800 0.001
ovarian cancer -5.000 0.000
head and neck cancer -1.800 0.002

Synonym

Accession Q8IVE3 Q5JPJ6 Q6P4Q1 Q8N3Q3
Symbols PLEKHH1L

Gene

Gene RIF (3)

PMID Text
22832517 Suggest a structural and functional role for Plekhh2 in the podocyte foot processes.
18752002 PLEKHH2, which has mRNA and protein expression exclusively in the glomerulus, may be a genetic risk factor for susceptibility to diabetic nephropathy in the diabetic population
18752002 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAFQQVQVMEDKL      1 - 70
KAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEAKIIEEKAAKIKEWVTVKLNE     71 - 140
LELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKLSEGQRLSSLTFGCFLSRARSPPQVVKSE    141 - 210
EMSKISSKEPEFTEGKDMEEMEIPEKSVDNQVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSG    211 - 280
APVSDWSSDEEDGSKGRSKSRCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKK    281 - 350
LYSWQQEAQWKALNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHP    351 - 420
NSLSGKGTQLVPSSHLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIRPLRPQETDLD    421 - 490
LVDGDSTEVLENMDTSCDDGLFSYDSLDSPNSDDQEHCDSAKKVAYSKPPTPPLHRFPSWESRIYAVAKS    491 - 560
GIRMSEAFNMESVNKNSAATLSYTTSGLYTSLIYKNMTTPVYTTLKGKATQISSSPFLDDSSGSEEEDSS    561 - 630
RSSSRTSESDSRSRSGPGSPRAMKRGVSLSSVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGK    631 - 700
NEPLEKSGYLLKMSGKVKSWKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTT    701 - 770
EKHTYYLTADSPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYY    771 - 840
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLLIGSKHEKDTW    841 - 910
LYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLF    911 - 980
KTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEICCQLIKQTRRRQPQNQPGPLQGWQLLALCV    981 - 1050
GLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLP   1051 - 1120
FSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDII   1121 - 1190
SKWEQASKEQQPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA   1191 - 1260
ALLSQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRLSTRWMALRGH   1261 - 1330
SAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAVHEDGLSLLEYNSMRLIVSYVYKSLMTF   1331 - 1400
GGYQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLIASYINNFHQQKAAFHHLSAPALLSAQTRGP   1401 - 1470
QARMMGSQPLLSSSRPTKGPTLL                                                  1471 - 1493
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22832517 2012 Plekhh2, a novel podocyte protein downregulated in human focal segmental glomerulosclerosis, is involved in matrix adhesion and actin dynamics.
18752002 2008 Sequence variants in the PLEKHH2 region are associated with diabetic nephropathy in the GoKinD study population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...