Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.51
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.200 1.3e-02
Astrocytoma, Pilocytic 2.700 2.6e-09
Breast cancer -3.100 4.3e-02
breast carcinoma -1.300 1.5e-28
ductal carcinoma in situ -1.800 8.7e-04
glioblastoma 1.800 2.0e-04
group 4 medulloblastoma -1.200 1.5e-03
head and neck cancer -1.800 2.2e-03
interstitial cystitis -1.200 1.3e-02
intraductal papillary-mucinous adenoma (... 1.700 2.2e-03
intraductal papillary-mucinous carcinoma... 1.800 8.2e-03
invasive ductal carcinoma -1.688 7.0e-05
lung adenocarcinoma -1.300 2.1e-08
lung carcinoma -2.900 2.8e-21
non-small cell lung cancer -2.889 1.4e-27
osteosarcoma 1.578 2.1e-02
ovarian cancer -5.000 2.0e-21
pediatric high grade glioma 1.500 2.3e-03

Gene RIF (3)

AA Sequence

MAELSEPEGPVDWKERCVALESQLMKFRVQASKIRELLAEKMQQLERQVIDAERQAEKAFQQVQVMEDKL      1 - 70
KAANIQTSESETRLYNKCQDLESLIQEKDDVIQNLELQLEEQKQIRIQEAKIIEEKAAKIKEWVTVKLNE     71 - 140
LELENQNLRLINQNQTEEIRTMQSKLQEVQGKKSSTVSTLKLSEGQRLSSLTFGCFLSRARSPPQVVKSE    141 - 210
EMSKISSKEPEFTEGKDMEEMEIPEKSVDNQVLENNRGQRTLHQTPCGSEQNRKTRTSFATDGGISQNSG    211 - 280
APVSDWSSDEEDGSKGRSKSRCTSTLSSHTSEEGVQCSRMGSEMYLTASDDSSSIFEEETFGIKRPEHKK    281 - 350
LYSWQQEAQWKALNSPLGKGNSELSKKEQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPALMPKHP    351 - 420
NSLSGKGTQLVPSSHLPPPKLRIPNVFSISVALAKRHLSQPQLSSDRMFGTNRNAISMIRPLRPQETDLD    421 - 490
LVDGDSTEVLENMDTSCDDGLFSYDSLDSPNSDDQEHCDSAKKVAYSKPPTPPLHRFPSWESRIYAVAKS    491 - 560
GIRMSEAFNMESVNKNSAATLSYTTSGLYTSLIYKNMTTPVYTTLKGKATQISSSPFLDDSSGSEEEDSS    561 - 630
RSSSRTSESDSRSRSGPGSPRAMKRGVSLSSVASESDYAIPPDAYSTDTEYSQPEQKLPKTCSSSSDNGK    631 - 700
NEPLEKSGYLLKMSGKVKSWKRRWFVLKGGELLYYKSPSDVIRKPQGHIELSASCSILRGDNKQTVQLTT    701 - 770
EKHTYYLTADSPNILEEWIKVLQNVLRVQAANPLSLQPEGKPTMKGLLTKVKHGYSKRVWCTLIGKTLYY    771 - 840
FRSQEDKFPLGQIKLWEAKVEEVDRSCDSDEDYEASGRSLLSTHYTIVIHPKDQGPTYLLIGSKHEKDTW    841 - 910
LYHLTVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLF    911 - 980
KTCQLFINAAVDSPAIDYHISLAQSALQICLTHPELQNEICCQLIKQTRRRQPQNQPGPLQGWQLLALCV    981 - 1050
GLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLP   1051 - 1120
FSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIKICDII   1121 - 1190
SKWEQASKEQQPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMA   1191 - 1260
ALLSQVEIGDFERPFSTPAGHVTNQCKVNQTLKQVIEKFYPKRYRDGCSEEQLRQLCQRLSTRWMALRGH   1261 - 1330
SAADCVRIYLTVARKWPFFGAKLFLAKPITPSSLGSTFLWLAVHEDGLSLLEYNSMRLIVSYVYKSLMTF   1331 - 1400
GGYQDDFMVVINNTHSKDKPTEKLLFAMAKPKILEITLLIASYINNFHQQKAAFHHLSAPALLSAQTRGP   1401 - 1470
QARMMGSQPLLSSSRPTKGPTLL                                                  1471 - 1493
//

Text Mined References (11)

PMID Year Title