Property Summary

NCBI Gene PubMed Count 2
PubMed Score 20.33

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IVE0 Q96PW6
Symbols CROCCL2
dJ798A10.2

Gene

PANTHER Protein Class (2)

AA Sequence

MRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDSTMQAHEDAQREVQRLRSAKELLRREKSN      1 - 70
LAHSLQVAQQQAKELRQERKKLQAAQEELRRQRYWLGEEQEDAVQDGVRVRRELERSHRQLEQLEGKRSV     71 - 140
LAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEGRGGLPAGLPVQAERPQREPCSGQVGSEPPCHP    141 - 210
GHSWRKKSAPCRAGSGRRSRRPQWHGKSRSGWRRCGWNRRWRGRAWRAPYERRSRPRRQWSSSSPRCIMS    211 - 280
AAGCRSS                                                                   281 - 287
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.