Property Summary

NCBI Gene PubMed Count 2
PubMed Score 20.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.3e-03
group 4 medulloblastoma 1855 3.3e-03
astrocytic glioma 2597 2.8e-02
oligodendroglioma 2850 2.9e-02
ependymoma 4679 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count Z-score Confidence
Allergic rhinitis 94 0.0 1.1
Disease Target Count Z-score Confidence
Large cell medulloblastoma 5 4.662 2.3

AA Sequence

MRGRYEASQDLLGTLRKQLSDSESERRALEEQLQRLRDKTDSTMQAHEDAQREVQRLRSAKELLRREKSN      1 - 70
LAHSLQVAQQQAKELRQERKKLQAAQEELRRQRYWLGEEQEDAVQDGVRVRRELERSHRQLEQLEGKRSV     71 - 140
LAKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEGRGGLPAGLPVQAERPQREPCSGQVGSEPPCHP    141 - 210
GHSWRKKSAPCRAGSGRRSRRPQWHGKSRSGWRRCGWNRRWRGRAWRAPYERRSRPRRQWSSSSPRCIMS    211 - 280
AAGCRSS                                                                   281 - 287
//

Text Mined References (4)

PMID Year Title