Property Summary

NCBI Gene PubMed Count 7
PubMed Score 9.09
PubTator Score 6.01

Knowledge Summary

Patent (1,278)

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.5e-06

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 1.5e-06

AA Sequence

MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWL      1 - 70
VLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLR     71 - 140
LNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPG    141 - 210
FERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFY    211 - 280
PDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQ    281 - 350
NCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN    351 - 420
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQ    421 - 490
EATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSK    491 - 560
DEEGRASQEGPPGPE                                                           561 - 575
//

Text Mined References (11)

PMID Year Title
17032767 2006 Interplay between PIP3 and calmodulin regulation of olfactory cyclic nucleotide-gated channels.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16382102 2005 International Union of Pharmacology. LI. Nomenclature and structure-function relationships of cyclic nucleotide-regulated channels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15195096 2004 Calmodulin permanently associates with rat olfactory CNG channels under native conditions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12649326 2003 Importance of the CNGA4 channel gene for odor discrimination and adaptation in behaving mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11764791 2001 Nomenclature for ion channel subunits.
11739959 2001 Central role of the CNGA4 channel subunit in Ca2+-calmodulin-dependent odor adaptation.