Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
Funding $24,715.34
PubMed Score 12.24
PubTator Score 14.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q8IV76 Q3MNE0 Q69HD7 Q8N7X9
Symbols CT63
OXTES1

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
25936801 PASD1 is a circadian bHLH-PAS paralog repressor of CLOCK protein expression.
20861911 PASD1-derived epitopes are both efficiently and selectively processed and presented by native human multiple myeloma cells as cancer vaccines.

AA Sequence

MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPA      1 - 70
EIVGKKLLSLLPDEEKDEVYQKIILKFPLLNSETHIEFCCHLKRGNVEHGDSSAYENVKFIVNVRDICNE     71 - 140
FPVVFSGLFSSHLCADFAACVPQEDRLYLVGNVCILRTQLLQQLYTSKAVSDEAVLTQDSDEEPFVGELS    141 - 210
SSQGQRGHTSMKAVYVEPAAAAAAAAISDDQIDIAEVEQYGPQENVHMFVDSDSTYCSSTVFLDTMPESP    211 - 280
ALSLQDFRGEPEVNPLYRADPVDLEFSVDQVDSVDQEGPMDQQDPENPVAPLDQAGLMDPVDPEDSVDLG    281 - 350
AAGASAQPLQPSSPVAYDIISQELELMKKLKEQLEERTWLLHDAIQNQQNALELMMDHLQKQPNTLRHVV    351 - 420
IPDLQSSEAVPKKQQKQHAGQVKRPLPHPKDVKCFCGLSLSNSLKNTGELQEPCVAFNQQQLVQQEQHLK    421 - 490
EQQRQLREQLQQLREQRKVQKQKKMQEKKKLQEQKMQEKKKLQEQRRQKKKKLQERKKWQGQMLQKEPEE    491 - 560
EQQKQQLQEQPLKHNVIVGNERVQICLQNPRDVSVPLCNHPVRFLQAQPIVPVQRAAEQQPSGFYQDENC    561 - 630
GQQEDESQSFYPEAYQGPPVNQLPLIDTSNSEAISSSSIPQFPITSDSTISTLETPQDYIRLWQELSDSL    631 - 700
GPVVQVNTWSCDEQGTLHGQPTYHQVQVSEVGVEGPPDPQAFQGPAAYQPDQMRSAEQTRLMPAEQRDSN    701 - 770
KPC                                                                       771 - 773
//

Text Mined References (18)

PMID Year Title
25936801 2015 Cancer/Testis Antigen PASD1 Silences the Circadian Clock.
20861911 2010 DNA vaccines to target the cancer testis antigen PASD1 in human multiple myeloma.
19886887 2010 Elevated expression levels of testis-specific genes TEX101 and SPATA19 in basal cell carcinoma and their correlation with clinical and pathological features.
19552722 2009 Cytolytic T-cell response to the PASD1 cancer testis antigen in patients with diffuse large B-cell lymphoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17114574 2006 PASD1 is a potential multiple myeloma-associated antigen.
17024112 2006 PASD1, a DLBCL-associated cancer testis antigen and candidate for lymphoma immunotherapy.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16112646 2005 Humoral detection of leukaemia-associated antigens in presentation acute myeloid leukaemia.
More...