Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
R01 Count 1
Funding $102,000
PubMed Score 5.03
PubTator Score 3.38

Knowledge Summary

Patent (679)

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma -1.900 0.000
osteosarcoma -1.057 0.000
glioblastoma -1.300 0.000
group 3 medulloblastoma -1.300 0.005
tuberculosis and treatment for 6 months -1.500 0.000
pediatric high grade glioma -1.300 0.000
atypical teratoid/rhabdoid tumor -1.300 0.000
pilocytic astrocytoma -1.500 0.000
Pick disease -1.100 0.000

Synonym

Accession Q8IV63 A6NEG5 A8KA53 Q502Y2 Q9P2V8
Symbols

Gene

 Grant Application (1)

PDB

2JII  

  TechDev Info (1)

Jing-Ruey Yeh gRNA validated for zebrafish model

Gene RIF (2)

PMID Text
25899223 These data suggest that VRK3-mediated phosphorylation of BAF may facilitate DNA replication or gene expression by facilitating the dissociation of nuclear envelope proteins and chromatin during interphase.
23082977 Data from molecular dynamic simulations suggest that bivalent cations play key structural roles in stabilization of VRK1/VRK2; bivalent cations have no obvious effects on VRK3. These kinases are targets in search for antineoplastic agents. [REVIEW]

AA Sequence

MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVT      1 - 70
SPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL     71 - 140
KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGR    141 - 210
LFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSE    211 - 280
RSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH    281 - 350
EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH    351 - 420
WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP                    421 - 474
//

Text Mined References (21)

PMID Year Title
25899223 2015 Presumed pseudokinase VRK3 functions as a BAF kinase.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23082977 2013 Role of bivalent cations in structural stabilities of new drug targets--vaccinia-related kinases (VRK) from molecular dynamics simulations.
22572157 Sensitive detection of idiotypic platelet-reactive alloantibodies by an electrical protein chip.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19141289 2009 Structure of the pseudokinase VRK3 reveals a degraded catalytic site, a highly conserved kinase fold, and a putative regulatory binding site.
More...