Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.61
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.6e-09
osteosarcoma 7950 4.4e-08
malignant mesothelioma 3232 2.3e-05
interstitial cystitis 2312 7.9e-04
cutaneous lupus erythematosus 1057 4.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 4.7e-03
interstitial cystitis 1.700 7.9e-04
malignant mesothelioma 1.200 2.3e-05
osteosarcoma -3.260 4.4e-08
ovarian cancer 1.300 1.6e-09

Gene RIF (1)

AA Sequence

MESRAEGGSPAVFDWFFEAACPASLQEDPPILRQFPPDFRDQEAMQMVPKFCFPFDVEREPPSPAVQHFT      1 - 70
FALTDLAGNRRFGFCRLRAGTQSCLCILSHLPWFEVFYKLLNTVGDLLAQDQVTEAEELLQNLFQQSLSG     71 - 140
PQASVGLELGSGVTVSSGQGIPPPTRGNSKPLSCFVAPDSGRLPSIPENRNLTELVVAVTDENIVGLFAA    141 - 210
LLAERRVLLTASKLSTLTSCVHASCALLYPMRWEHVLIPTLPPHLLDYCCAPMPYLIGVHASLAERVREK    211 - 280
ALEDVVVLNVDANTLETTFNDVQALPPDVVSLLRLRLRKVALAPGEGVSRLFLKAQALLFGGYRDALVCS    281 - 350
PGQPVTFSEEVFLAQKPGAPLQAFHRRAVHLQLFKQFIEARLEKLNKGEGFSDQFEQEITGCGASSGALR    351 - 420
SYQLWADNLKKGGGALLHSVKAKTQPAVKNMYRSAKSGLKGVQSLLMYKDGDSVLQRGGSLRAPALPSRS    421 - 490
DRLQQRLPITQHFGKNRPLRPSRRRQLEEGTSEPPGAGTPPLSPEDEGCPWAEEALDSSFLGSGEELDLL    491 - 560
SEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKLPEPEPQPLSLPSLQNASSLD    561 - 630
ATSSSKDSRSQLIPSESDQEVTSPSQSSTASADPSIWGDPKPSPLTEPLILHLTPSHKAAEDSTAQENPT    631 - 700
PWLSTAPTEPSPPESPQILAPTKPNFDIAWTSQPLDPSSDPSSLEDPRARPPKALLAERAHLQPREEPGA    701 - 770
LNSPATPTSNCQKSQPSSRPRVADLKKCFEG                                           771 - 801
//

Text Mined References (10)

PMID Year Title