Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.54
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25367361 Association between leprosy and tag SNPs at NOD2 (rs8057431) and CCDC122-LACC1 (rs4942254).
25220867 There is an association of a mutation in LACC1 with a monogenic form of systemic juvenile idiopathic arthritis.
20473688 Observational study of gene-disease association. (HuGE Navigator)
20018961 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS      1 - 70
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG     71 - 140
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF    141 - 210
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL    211 - 280
GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA    281 - 350
EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG    351 - 420
TQIGFISIKE                                                                421 - 430
//

Text Mined References (20)

PMID Year Title
27478939 2016 C13orf31 (FAMIN) is a central regulator of immunometabolic function.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25367361 2014 NOD2 and CCDC122-LACC1 genes are associated with leprosy susceptibility in Brazilians.
25220867 2015 Association of a mutation in LACC1 with a monogenic form of systemic juvenile idiopathic arthritis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22504414 2012 Association between C13ORF31, NOD2, RIPK2 and TLR10 polymorphisms and urothelial bladder cancer.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20473688 2010 Association between genome-wide association studies reported SNPs and pediatric-onset Crohn's disease in Canadian children.
20018961 2009 Genomewide association study of leprosy.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
More...