Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.47
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.015 1.2e-02
atypical teratoid / rhabdoid tumor -1.300 7.5e-04
cystic fibrosis 1.280 7.2e-04
group 3 medulloblastoma -1.800 1.5e-02
intraductal papillary-mucinous adenoma (... 1.600 6.4e-03
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
medulloblastoma, large-cell -2.200 7.5e-05
oligodendroglioma -2.100 3.7e-02
osteosarcoma -2.011 6.4e-04
ovarian cancer -1.400 3.7e-04
Pick disease -1.600 1.6e-02
posterior fossa group B ependymoma -1.300 8.1e-04
progressive supranuclear palsy -2.000 1.7e-02
tuberculosis -3.300 1.2e-09

Synonym

Accession Q8IV20 A2A3Z6 Q8N8X5
Symbols FAMIN
C13orf31

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (10)

AA Sequence

MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS      1 - 70
ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG     71 - 140
GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF    141 - 210
NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL    211 - 280
GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA    281 - 350
EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG    351 - 420
TQIGFISIKE                                                                421 - 430
//

Text Mined References (26)

PMID Year Title