Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.31
PubTator Score 4.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 5.5e-04
chronic rhinosinusitis -1.362 2.1e-02
glioblastoma -1.200 7.4e-04
interstitial cystitis -1.200 6.2e-04
lung adenocarcinoma -1.400 4.3e-16
lung cancer 1.100 1.4e-02
lung carcinoma 1.400 7.2e-13
malignant mesothelioma -1.400 4.1e-06
medulloblastoma, large-cell -1.200 6.3e-05
non-small cell lung carcinoma -1.100 2.5e-16
ovarian cancer -1.500 1.7e-05
Pick disease -1.400 3.6e-04

Gene RIF (1)

AA Sequence

MIPGKYRSVSGRAANNVNCGLHLVIQTSSLPEKNKVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINL      1 - 70
VSSSLSSFPILQRSSEEKILYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNISNLQKLISLD     71 - 140
LYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLENLKSLDVLDLHGNQITKIENINHLCELRVLNLARN    141 - 210
FLSHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNP    211 - 280
IAQESWYKHTVLQNMMQLRQLDMKRITEEERRMASVLAKKEEEKKRESHKQSLLKEKKRLTINNVARQWD    281 - 350
LQQQRVANIATNEDRKDSDSPQDPCQIDGSTLSAFPEETGPLDSGLNNALQGLSVIDTYLVEVDGDTLSL    351 - 420
YGSGALESLDRNWSVQTAGMITTVSFTFIEFDEIVQVLPKLKIKFPNSLHLKFKETNLVMLQQFNALAQL    421 - 490
RRIDQLTIDPQGNPVVNFTLWKYYVLFRLSHFSMQKINGTEVTQNDMIMAERLFGILAHVASSELPQYRL    491 - 560
ISILGDARKKQFRYLLESKGKKPGIINEENNDSKRLVGENTNRATLNYTTRDFYNEKLEEIKEKKKFCKT    561 - 630
YIEDLVKEATEINMKNEALQKLWPQMFIELVRDAVIEIRNKNSYMKLCLQQITDQK                  631 - 686
//

Text Mined References (8)

PMID Year Title