Property Summary

NCBI Gene PubMed Count 22
PubMed Score 39.53
PubTator Score 24.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.352 4.4e-03
adult high grade glioma 1.800 2.4e-03
astrocytoma 1.100 3.7e-04
Astrocytoma, Pilocytic 2.100 3.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.095 2.9e-02
Breast cancer 1.800 2.4e-06
cystic fibrosis -1.080 3.6e-04
ependymoma 1.700 1.1e-04
gastric carcinoma 2.000 1.5e-02
glioblastoma 1.600 8.1e-05
interstitial lung disease 1.200 4.1e-02
intraductal papillary-mucinous adenoma (... -1.400 1.9e-03
intraductal papillary-mucinous carcinoma... -1.700 1.8e-03
invasive ductal carcinoma 1.455 1.2e-02
lung carcinoma -1.200 4.0e-10
malignant mesothelioma 4.800 1.2e-09
ovarian cancer -2.800 5.4e-07
pancreatic cancer 1.400 3.5e-03
pituitary cancer -1.900 1.2e-06
primary pancreatic ductal adenocarcinoma 2.254 2.9e-04
psoriasis -1.600 4.4e-04
subependymal giant cell astrocytoma 1.785 3.9e-02

Gene RIF (7)

AA Sequence

MAAVRGAPLLSCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREDDVEAPPPPEPTPRVRKAQ      1 - 70
AGGKPGKRPGTAAEVPPEKTKDKGKKGKKDKGPKVPKESLEGSPRPPKKGKEKPPKATKKPKEKPPKATK     71 - 140
KPKEKPPKATKKPKEKPPKATKKPPSGKRPPILAPSETLEWPLPPPPSPGPEELPQEGGAPLSNNWQNPG    141 - 210
EETHVEAREHQPEPEEETEQPTLDYNDQIEREDYEDFEYIRRQKQPRPPPSRRRRPERVWPEPPEEKAPA    211 - 280
PAPEERIEPPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPK    281 - 350
EETDKWAVEKGKDHKEPRKGEELEEEWTPTEKVKCPPIGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQ    351 - 420
TGATEDDYYDGAWCAEDDARTQWIEVDTRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSNDSQTWVMYTN    421 - 490
GYEEMTFHGNVDKDTPVLSELPEPVVARFIRIYPLTWNGSLCMRLEVLGCSVAPVYSYYAQNEVVATDDL    491 - 560
DFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIYAMEISDNPGEHELGEPEFRYTAGIHGNEVL    561 - 630
GRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLVPSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFE    631 - 700
DFPDLNSVLWGAEERKWVPYRVPNNNLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVS    701 - 770
YPYDMARTPTQEQLLAAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYT    771 - 840
GGMGIVNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTFMEQVHRGIKG    841 - 910
VVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNF    911 - 980
ILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQRRLQHRLRLRAQMRLRRLNATTTLGPHTVP    981 - 1050
PTLPPAPATTLSTTIEPWGLIPPTTAGWEESETETYTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQ   1051 - 1120
LEPEFEEEEEEEKEEEIATGQAFPFTTVETYTVNFGDF                                   1121 - 1158
//

Text Mined References (25)

PMID Year Title