Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.02
PubTator Score 183.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia 1.100 4.1e-02
acute quadriplegic myopathy 1.310 8.5e-04
adult high grade glioma -1.600 1.3e-03
atypical teratoid / rhabdoid tumor -1.100 9.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.003 1.4e-02
Breast cancer -1.200 5.0e-09
breast carcinoma -1.100 1.5e-22
ductal carcinoma in situ -1.100 2.1e-04
glioblastoma -1.300 9.8e-05
hepatocellular carcinoma -1.200 8.8e-05
invasive ductal carcinoma -1.300 9.8e-04
juvenile dermatomyositis 1.446 7.5e-10
lung adenocarcinoma -1.200 2.1e-10
medulloblastoma, large-cell -2.200 2.1e-03
non-small cell lung cancer -1.100 4.4e-15
osteosarcoma 1.676 7.3e-05
ovarian cancer -1.800 5.7e-07
Pick disease 1.400 5.4e-05
psoriasis -1.400 9.9e-13
Rheumatoid arthritis 1.400 3.3e-03
spina bifida -1.554 3.5e-02
tuberculosis 1.200 2.2e-03
ulcerative colitis -1.400 9.2e-05

Gene RIF (2)

AA Sequence

MPQPSVSGMDPPFGDAFRSHTFSEQTLMSTDLLANSSDPDFMYELDREMNYQQNPRDNFLSLEDCKDIEN      1 - 70
LESFTDVLDNEGALTSNWEQWDTYCEDLTKYTKLTSCDIWGTKEVDYLGLDDFSSPYQDEEVISKTPTLA     71 - 140
QLNSEDSQSVSDSLYYPDSLFSVKQNPLPSSFPGKKITSRAAAPVCSSKTLQAEVPLSDCVQKASKPTSS    141 - 210
TQIMVKTNMYHNEKVNFHVECKDYVKKAKVKINPVQQSRPLLSQIHTDAAKENTCYCGAVAKRQEKKGME    211 - 280
PLQGHATPALPFKETQELLLSPLPQEGPGSLAAGESSSLSASTSVSDSSQKKEEHNYSLFVSDNLGEQPT    281 - 350
KCSPEEDEEDEEDVDDEDHDEGFGSEHELSENEEEEEEEEDYEDDKDDDISDTFSEPGYENDSVEDLKEV    351 - 420
TSISSRKRGKRRYFWEYSEQLTPSQQERMLRPSEWNRDTLPSNMYQKNGLHHGKYAVKKSRRTDVEDLTP    421 - 490
NPKKLLQIGNELRKLNKVISDLTPVSELPLTARPRSRKEKNKLASRACRLKKKAQYEANKVKLWGLNTEY    491 - 560
DNLLFVINSIKQEIVNRVQNPRDERGPNMGQKLEILIKDTLGLPVAGQTSEFVNQVLEKTAEGNPTGGLV    561 - 630
GLRIPTSKV                                                                 631 - 639
//

Text Mined References (11)

PMID Year Title