Property Summary

NCBI Gene PubMed Count 8
Grant Count 31
R01 Count 9
Funding $6,387,567.86
PubMed Score 71.98
PubTator Score 22.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma -3.500 0.000
glioblastoma -3.300 0.000
group 4 medulloblastoma -3.200 0.022
atypical teratoid/rhabdoid tumor -3.200 0.000
pediatric high grade glioma -3.300 0.001
pilocytic astrocytoma -3.400 0.001
pituitary cancer -3.500 0.000

Gene RIF (4)

PMID Text
26690124 This review summarizes the current knowledge of the roles that Npas4 may play in neuroinflammation and ischemia. [review]
24887558 we provide the first evidence that Npas4 is expressed during embryonic development and that it may have a developmental role that is unrelated to its function in the adult brain
24465693 These results provide insight into the mechanisms of NPAS4/ARNT dimerisation and transcriptional activation.
14701734 a novel NXF signaling system on neural gene promoter may be a molecular target of the adverse effects of Sim2 in the mental retardation of Down's syndrome

AA Sequence

MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLS      1 - 70
AQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTLPSA     71 - 140
LDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPA    141 - 210
SLFLAMFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEM    211 - 280
VVRLQAKTGGWAWIYCLLYSEGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENI    281 - 350
LSQEECSSTNPLFTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLTFPSGPEPSLQAELSKDL    351 - 420
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLT    421 - 490
ETSVRSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQAHLDSPSQTFPEQLSPNPTKT    491 - 560
YFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYSEKEQN    561 - 630
EIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADP    631 - 700
DNMFLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSA    701 - 770
FPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF                                          771 - 802
//

Text Mined References (9)

PMID Year Title
26690124 2015 The Role of the Neuroprotective Factor Npas4 in Cerebral Ischemia.
24887558 2014 A reduction in Npas4 expression results in delayed neural differentiation of mouse embryonic stem cells.
24465693 2014 Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701734 2004 Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.