Property Summary

NCBI Gene PubMed Count 8
PubMed Score 71.98
PubTator Score 22.18

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
ependymoma 2514 1.61810235746283E-9
glioblastoma 5572 1.01241145706339E-6
pituitary cancer 1972 5.17152274367615E-5
atypical teratoid/rhabdoid tumor 1095 4.94103419413781E-4
pilocytic astrocytoma 3086 6.57592816549687E-4
pediatric high grade glioma 2712 0.00120837311902691
group 4 medulloblastoma 1875 0.0223566610088315
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 3.26 1.6
Autistic Disorder 320 3.022 1.5


  Differential Expression (7)

Disease log2 FC p
ependymoma -3.500 0.000
glioblastoma -3.300 0.000
group 4 medulloblastoma -3.200 0.022
atypical teratoid/rhabdoid tumor -3.200 0.000
pediatric high grade glioma -3.300 0.001
pilocytic astrocytoma -3.400 0.001
pituitary cancer -3.500 0.000


Accession Q8IUM7 B7ZL81 Q8N8S5 Q8N9Q9 Neuronal PAS4
Symbols NXF


  Ortholog (11)

Gene RIF (4)

26690124 This review summarizes the current knowledge of the roles that Npas4 may play in neuroinflammation and ischemia. [review]
24887558 we provide the first evidence that Npas4 is expressed during embryonic development and that it may have a developmental role that is unrelated to its function in the adult brain
24465693 These results provide insight into the mechanisms of NPAS4/ARNT dimerisation and transcriptional activation.
14701734 a novel NXF signaling system on neural gene promoter may be a molecular target of the adverse effects of Sim2 in the mental retardation of Down's syndrome

AA Sequence

FPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF                                          771 - 802

Text Mined References (9)

PMID Year Title
26690124 2015 The Role of the Neuroprotective Factor Npas4 in Cerebral Ischemia.
24887558 2014 A reduction in Npas4 expression results in delayed neural differentiation of mouse embryonic stem cells.
24465693 2014 Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701734 2004 Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.