Property Summary

NCBI Gene PubMed Count 9
PubMed Score 80.58
PubTator Score 22.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -3.100 2.5e-02
Astrocytoma, Pilocytic -3.400 5.7e-04
atypical teratoid / rhabdoid tumor -1.900 7.2e-03
ependymoma -3.500 1.6e-09
glioblastoma -3.300 1.0e-06
group 4 medulloblastoma -3.200 2.2e-02
pituitary cancer -3.500 5.2e-05

Gene RIF (5)

AA Sequence

MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGTPLAGPTGLLS      1 - 70
AQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIYDIIDPADHLTVRQQLTLPSA     71 - 140
LDTDRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGAYWAGNPVFTAFCAPLEPRPRPGPGPGPGPA    141 - 210
SLFLAMFQSRHAKDLALLDISESVLIYLGFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEM    211 - 280
VVRLQAKTGGWAWIYCLLYSEGPEGPITANNYPISDMEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENI    281 - 350
LSQEECSSTNPLFTAALGAPRSTSFPSAPELSVVSASEELPRPSKELDFSYLTFPSGPEPSLQAELSKDL    351 - 420
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPTPSSTLQEQLTPSTATFSDQLTPSSATFPDPLTSPLQGQLT    421 - 490
ETSVRSYEDQLTPCTSTFPDQLLPSTATFPEPLGSPAHEQLTPPSTAFQAHLDSPSQTFPEQLSPNPTKT    491 - 560
YFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSVDVPLVPEGLLTPEASPVKQSFFHYSEKEQN    561 - 630
EIDRLIQQISQLAQGMDRPFSAEAGTGGLEPLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADP    631 - 700
DNMFLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSA    701 - 770
FPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF                                          771 - 802
//

Text Mined References (10)

PMID Year Title