Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8IUI4
Symbols RUNDC2C

Gene

 Compartment GO Term (0)

AA Sequence

MDEERSSMLPTMAAGPNSILFAINIDNKDLNGQSKFAPTVSDLLKESTQNVTLLKESTQGVSSVFREITA      1 - 70
SSAISILIKPEQETDPLPVVSRNVSADAKCKKERKKKKQVTNIISFDDEEDEQNSGDMFKKTPGAGESSE     71 - 140
DNSDHSSVNIMSAFESPFGPNSNGSQSSNSWKIDSLSLNREFGYQKLDVKSIDDEDVDENEDDVYGNSSG    141 - 210
RKHRGHSESPEKNGAHSVTQAGVQWHDLSSLQPLPPGFK                                   211 - 249
//

Text Mined References (4)

PMID Year Title