Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


Accession Q8IUI4
Symbols RUNDC2C


 Compartment GO Term (0)

AA Sequence

RKHRGHSESPEKNGAHSVTQAGVQWHDLSSLQPLPPGFK                                   211 - 249

Text Mined References (4)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.