Property Summary

NCBI Gene PubMed Count 4
Grant Count 6
R01 Count 6
Funding $270,071.79
PubMed Score 0.62
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -3.400 0.000
ependymoma -4.300 0.001
oligodendroglioma -3.700 0.000
glioblastoma -4.900 0.000
medulloblastoma -5.100 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -5.100 0.001
primitive neuroectodermal tumor -3.200 0.014
intraductal papillary-mucinous neoplasm ... 1.500 0.006
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -4.100 0.000
ovarian cancer -1.700 0.000

Gene RIF (1)

PMID Text
12408961 CREG2 are putative secreted glycoproteins and may be novel neuronal extracellular molecules.

AA Sequence

MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIW      1 - 70
QQSFPASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLA     71 - 140
TVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDP    141 - 210
EDPRCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISRE    211 - 280
EYFKAVPRKA                                                                281 - 290
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408961 2002 Identification and characterization of novel members of the CREG family, putative secreted glycoproteins expressed specifically in brain.