Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.62
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 7.54431191459E-21
oligodendroglioma 2849 2.89628729597444E-19
atypical teratoid / rhabdoid tumor 4369 2.90435116126735E-8
medulloblastoma 1524 7.051369980567E-8
ovarian cancer 8492 2.08189135338823E-7
glioblastoma 5572 5.91537084903481E-6
pilocytic astrocytoma 3086 6.51884398749456E-6
pediatric high grade glioma 2712 1.09452193786116E-4
ependymoma 2514 0.00108443009039184
medulloblastoma, large-cell 6234 0.00119738538562113
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00629761177856999
primitive neuroectodermal tumor 3031 0.0138987037920697

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -3.400 0.000
ependymoma -4.300 0.001
oligodendroglioma -3.700 0.000
glioblastoma -4.900 0.000
medulloblastoma -5.100 0.000
atypical teratoid / rhabdoid tumor -4.800 0.000
medulloblastoma, large-cell -5.100 0.001
primitive neuroectodermal tumor -3.200 0.014
intraductal papillary-mucinous neoplasm ... 1.500 0.006
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -4.100 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q8IUH2 Q86X03 Q8N540 Q8N9E3
Symbols

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
12408961 CREG2 are putative secreted glycoproteins and may be novel neuronal extracellular molecules.

AA Sequence

MSVRRGRRPARPGTRLSWLLCCSALLSPAAGYVIVSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIW      1 - 70
QQSFPASAHKEDAHLRPRAGAARARPPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLA     71 - 140
TVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDP    141 - 210
EDPRCVQLTLTGQMIAVSPEEVEFAKQAMFSRHPGMRKWPRQYEWFFMKMRIEHIWLQKWYGGASSISRE    211 - 280
EYFKAVPRKA                                                                281 - 290
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12408961 2002 Identification and characterization of novel members of the CREG family, putative secreted glycoproteins expressed specifically in brain.