Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.34
PubTator Score 49.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Lung Neoplasms 171
Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.45548929244187E-14
medulloblastoma, large-cell 6234 1.13429537302103E-5
group 3 medulloblastoma 2254 1.15319925877366E-5
pilocytic astrocytoma 3086 2.69864305819381E-5
osteosarcoma 7933 1.30685729928231E-4
psoriasis 6685 1.6806636937766E-4
ovarian cancer 8492 0.00204246614326447
lung cancer 4473 0.00268840674579527
acute myeloid leukemia 785 0.00278616443633216
active Crohn's disease 918 0.0156959226527273
Breast cancer 3099 0.0394591937982441

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.400 0.000
osteosarcoma 1.845 0.000
posterior fossa group B ependymoma 2.100 0.000
group 3 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 2.100 0.000
lung cancer 1.400 0.003
active Crohn's disease 1.025 0.016
Breast cancer -2.100 0.039
pilocytic astrocytoma 1.100 0.000
acute myeloid leukemia -1.400 0.003
ovarian cancer 1.200 0.002

Synonym

Accession Q8IUF8 D3DN35 Q6AHW4 Q6SKS0 Q8IU69 Q8IUF6 Q8IUF7 Q96C17 Q96KB0
Symbols ROX
MDIG
NO52
MINA53

Gene

PDB

2XDV   4BU2   4BXF  

Gene RIF (22)

PMID Text
26608785 Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome.
26293673 Data suggest that mineral dust-induced gene protein (mdig) accomplishes its functions on chromatin, DNA repair and cell growth through interacting with the partner proteins.
25851349 in lung cancer tissues, upregulation of mdig expression accompanies with the downregulation of p27(KIP1) expression and in bronchial stump
25282476 Mina: a Th2 response regulator meets TGFbeta.
24522517 Mina53 can be used as a marker for pancreatic cancer
24505346 Increased expression of mdig in cancer tissues.
24434654 results show mdig induction by arsenic is partially dependent on the JNK and STAT3 signaling pathways.
24337011 mina53 expression was gradually elevated during gastric carcinogenesis, and the overexpression of mina53 was correlated with different clinicopathological features between diffuse-type gastric carcinoma and intestinal-type gastric carcinoma cases.
24309373 these data suggest that an increased expression of mdig is an important prognostic factor for poorer survival time of the breast cancer patients.
23965803 Results imply that mdig is involved in the regulation of H3K9me3 to influence the heterochromatin structure of the genome and the expression of genes important for cell growth or transformation.
More...

AA Sequence

MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD      1 - 70
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP     71 - 140
QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS    141 - 210
VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA    211 - 280
KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL    281 - 350
STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP    351 - 420
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV                             421 - 465
//

Text Mined References (38)

PMID Year Title
26608785 2015 Histone Modifier Genes Alter Conotruncal Heart Phenotypes in 22q11.2 Deletion Syndrome.
26293673 2015 The proteomic investigation reveals interaction of mdig protein with the machinery of DNA double-strand break repair.
25851349 2015 Mdig, a lung cancer-associated gene, regulates cell cycle progression through p27(KIP1).
25416956 2014 A proteome-scale map of the human interactome network.
25282476 2014 Mina: a Th2 response regulator meets TGF?.
24522517 2014 Potential effects of Mina53 on tumor growth in human pancreatic cancer.
24505346 2014 Paradoxical roles of mineral dust induced gene on cell proliferation and migration/invasion.
24434654 2014 Carcinogenic metalloid arsenic induces expression of mdig oncogene through JNK and STAT3 activation.
24337011 2014 Mina53, a novel molecular marker for the diagnosis and prognosis of gastric adenocarcinoma.
24309373 2014 Increased expression of mdig predicts poorer survival of the breast cancer patients.
More...