Property Summary

NCBI Gene PubMed Count 31
PubMed Score 29.93
PubTator Score 49.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Lung Neoplasms 232 0.0 0.0

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.025 1.6e-02
acute myeloid leukemia -1.400 2.8e-03
Astrocytoma, Pilocytic 1.100 2.5e-05
Breast cancer -2.100 3.9e-02
ependymoma 1.500 3.4e-08
group 3 medulloblastoma 1.400 3.1e-03
lung cancer -1.100 1.7e-03
medulloblastoma, large-cell 1.700 2.7e-04
osteosarcoma 1.461 1.3e-04
ovarian cancer 1.200 2.0e-03
psoriasis -1.400 1.7e-04

Gene RIF (23)

AA Sequence

MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIKTETFFKEFWEQKPLLIQRDD      1 - 70
PALATYYGSLFKLTDLKSLCSRGMYYGRDVNVCRCVNGKKKVLNKDGKAHFLQLRKDFDQKRATIQFHQP     71 - 140
QRFKDELWRIQEKLECYFGSLVGSNVYITPAGSQGLPPHYDDVEVFILQLEGEKHWRLYHPTVPLAREYS    141 - 210
VEAEERIGRPVHEFMLKPGDLLYFPRGTIHQADTPAGLAHSTHVTISTYQNNSWGDFLLDTISGLVFDTA    211 - 280
KEDVELRTGIPRQLLLQVESTTVATRRLSGFLRTLADRLEGTKELLSSDMKKDFIMHRLPPYSAGDGAEL    281 - 350
STPGGKLPRLDSVVRLQFKDHIVLTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFP    351 - 420
LSHLDALKQIWNSPAISVKDLKLTTDEEKESLVLSLWTECLIQVV                             421 - 465
//

Text Mined References (39)

PMID Year Title