Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.17
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.121 1.6

Gene RIF (2)

PMID Text
18663611 most prostate tumors (73.5%) express at least one of these genes (TGIFLX and TGIFLY), although different patterns of mRNA expression were observed. These results suggest an association of TGIFLX/Y expression with the progression of prostate cancer.
18384077 Association of TGIFLX/Y mRNA expression with azoospermia in infertile men.(

AA Sequence

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY      1 - 70
KHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA     71 - 140
SVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEE    141 - 210
HADFSSFLLLVDAAVQRAAELELEKKQEPNP                                           211 - 241
//

Text Mined References (8)

PMID Year Title
22808956 2012 Genetically distinct subsets within ANCA-associated vasculitis.
18663611 2009 Association of TGIFLX/Y mRNA expression with prostate cancer.
18384077 2008 Association of TGIFLX/Y mRNA expression with azoospermia in infertile men.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226713 2002 The human-specific Yp11.2/Xq21.3 homology block encodes a potentially functional testis-specific TGIF-like retroposon.