Property Summary

NCBI Gene PubMed Count 8
PubMed Score 13.44
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.127 1.6

Gene RIF (2)

AA Sequence

MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMY      1 - 70
KHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEA     71 - 140
SVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEE    141 - 210
HADFSSFLLLVDAAVQRAAELELEKKQEPNP                                           211 - 241
//

Text Mined References (8)

PMID Year Title